Overview

  • Product name

  • Description

    Rabbit polyclonal to Geminin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Geminin aa 1-209.
    Sequence:

    MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSK RKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK EVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQY MAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVS SSTDAKPCI


    Database link: O75496

  • Positive control

    • SW480, 22RV-1, HL60, HepG2, MCF7 and K562 cell line extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.

Target

  • Function

    Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
  • Sequence similarities

    Belongs to the geminin family.
  • Developmental stage

    Absent during G1 phase, accumulates during S, G2, and M phases, and disappears at the time of the metaphase-anaphase transition.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA replication inhibitor antibody
    • Gem antibody
    • GEMI_HUMAN antibody
    • Geminin antibody
    • Geminin DNA replication inhibitor antibody
    • GMNN antibody
    • OTTHUMP00000039393 antibody
    • RP3 369A17.3 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling Geminin with ab187553 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling Geminin with ab187553 at 1/200. Magnification: 200x.
  • All lanes : Anti-HIF1AN/FIH-1 antibody (ab187524) at 1/500 dilution

    Lane 1 : SW480 cell line extract
    Lane 2 : 22RV-1 cell line extract
    Lane 3 : HL60 cell line extract
    Lane 4 : HepG2 cell line extract
    Lane 5 : MCF7 cell line extract
    Lane 6 : K562 cell line extract

    Predicted band size: 24 kDa

References

ab187553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up