Overview

  • Product name

  • Description

    Rabbit polyclonal to Geminin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Geminin aa 1-209.
    Sequence:

    MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSK RKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK EVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQY MAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVS SSTDAKPCI


    Database link: O75496

  • Positive control

    • WB: HCT 116 whole cell lysate. IP: HCT 116 whole cell extract. IHC-P: Human breast cancer tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 24 kDa.
ICC/IF 1/100 - 1/1000.
IP 1/100 - 1/500.
IHC-P 1/100 - 1/1000.

Target

  • Function

    Inhibits DNA replication by preventing the incorporation of MCM complex into prereplication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
  • Sequence similarities

    Belongs to the geminin family.
  • Developmental stage

    Absent during G1 phase, accumulates during S, G2, and M phases, and disappears at the time of the metaphase-anaphase transition.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA replication inhibitor antibody
    • Gem antibody
    • GEMI_HUMAN antibody
    • Geminin antibody
    • Geminin DNA replication inhibitor antibody
    • GMNN antibody
    • OTTHUMP00000039393 antibody
    • RP3 369A17.3 antibody
    see all

Images

  • Anti-Geminin antibody (ab229009) at 1/1000 dilution + HCT 116 (human colorectal carcinoma cell line) whole cell lysate at 30 µg

    Predicted band size: 24 kDa



    12% SDS-PAGE gel.

  • Geminin was immunoprecipitated from HCT 116 (human colorectal carcinoma cell line) whole cell extract with 5 μg of ab229009. Western blot was performed from the immunoprecipitate using ab229009. Anti-Rabbit IgG was used as a secondary reagent.

    Lane 1: Control IgG instead of ab229009 in HCT 116 whole cell etract.
    Lane 2: ab229009 IP in HCT116 whole cell extract.

  • Paraformaldehyde-fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Geminin (green) using ab229009 at 1/500 dilution in ICC/IF.

    Nuclear counterstain: Hoechst 33342 (blue).

  • Paraffin-embedded human breast cancer tissue stained for Geminin using ab229009 at 1/250 dilution in immunohistochemical analysis.

References

ab229009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up