Overview

  • Product name

  • Description

    Rabbit polyclonal to GFOD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human GFOD2 aa 331-385.
    Sequence:

    PVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEAL QRNNL


    Database link: Q3B7J2

  • Positive control

    • IHC-P: Human caudate tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Promotes matrix assembly.
  • Sequence similarities

    Belongs to the gfo/idh/mocA family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ23802 antibody
    • GFOD2 antibody
    • GFOD2_HUMAN antibody
    • Glucose fructose oxidoreductase domain containing 2 antibody
    • Glucose fructose oxidoreductase domain containing protein 2 antibody
    • Glucose-fructose oxidoreductase domain-containing protein 2 antibody
    • MGC11335 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling GFOD2 using ab243742 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human caudate tissue stained for GFOD2 with ab243742 at a 1/20 dilution in immunohistochemical analysis.

References

ab243742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up