Overview

  • Product name

  • Description

    Rabbit polyclonal to GFPP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse GFPP aa 314-513.
    Sequence:

    HVTKEESQLLDMRQKIFHLLKGTPLNVVVLNNSRFYHIGTLQEYLLHFTS DSALKTELGLQSIAFSVSPSVPERSSGTACVIHSIVDSGCCVAPGSVVEY SRLGPEVSIGENCIISSSVIAKTVVPAYSFLCSLSVKINGHLKYSTMVFG MQDNLKNSVKTLEDIKALQFFGVCFLSCLDIWNLKATEKLFSGNKMNLSL


    Database link: G5E8F4

  • Positive control

    • IHC-P: Mouse kidney and colon tissues. WB: A431 and HeLa cell lysates.
  • General notes

     This product was previously labelled as FPGT

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Catalyzes the formation of GDP-L-fucose from GTP and L-fucose-1-phosphate. Functions as a salvage pathway to reutilize L-fucose arising from the turnover of glycoproteins and glycolipids.
  • Tissue specificity

    Expressed in many tissues.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FPGT antibody
    • FPGT_HUMAN antibody
    • Fucose 1 phosphate guanyltransferase antibody
    • Fucose 1 phosphate guanylyltransferase antibody
    • Fucose-1-phosphate guanylyltransferase antibody
    • GDP beta L fucose pyrophosphorylase antibody
    • GDP L fucose diphosphorylase antibody
    • GDP L fucose pyrophosphorylase antibody
    • GDP-L-fucose diphosphorylase antibody
    • GDP-L-fucose pyrophosphorylase antibody
    • GFPP antibody
    see all

Images

  • Paraffin-embedded mouse colon tissue stained for GFPP with ab231029 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GFPP antibody (ab231029) at 2 µg/ml + A431 (Human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 65 kDa

  • Paraffin-embedded mouse kidney tissue stained for GFPP with ab231029 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GFPP antibody (ab231029) at 2 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 65 kDa

  • Anti-GFPP antibody (ab231029) at 2 µg/ml + Recombinant mouse GFPP protein

    Predicted band size: 65 kDa

References

ab231029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up