Overview

  • Product name
  • Description
    Rabbit polyclonal to GFPT1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GFPT1 aa 525-681 (C terminal). (BC045641).
    Sequence:

    DEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGE LKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKED TETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNL AKSVTVE


    Database link: Q06210-2

  • Positive control
    • WB: HeLa and Human kidney lysates. IHC-P: Human fetal testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 77 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
  • Tissue specificity
    Isoform 1 is predominantly expressed in skeletal muscle. Not expressed in brain. Seems to be selectively expressed in striated muscle.
  • Pathway
    Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; alpha-D-glucosamine 6-phosphate from D-fructose 6-phosphate: step 1/1.
  • Involvement in disease
    Defects in GFPT1 are the cause of limb-girdle myasthenia with tubular aggregates (LGMTA) [MIM:610542]. A congenital myasthenic syndrome characterized by onset of proximal muscle weakness in the first decade. Individuals with this condition have a recognizable pattern of weakness of shoulder and pelvic girdle muscles, and sparing of ocular or facial muscles. EMG classically shows a decremental response to repeated nerve stimulation, a sign of neuromuscular junction dysfunction. Affected individuals show a favorable response to acetylcholinesterase (AChE) inhibitors.
  • Sequence similarities
    Contains 1 glutamine amidotransferase type-2 domain.
    Contains 2 SIS domains.
  • Information by UniProt
  • Database links
  • Alternative names
    • CMS12 antibody
    • CMSTA1 antibody
    • D-fructose-6-phosphate amidotransferase 1 antibody
    • GFA antibody
    • GFAT 1 antibody
    • GFAT antibody
    • GFAT1 antibody
    • GFAT1m antibody
    • GFPT antibody
    • Gfpt1 antibody
    • GFPT1_HUMAN antibody
    • GFPT1L antibody
    • Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 antibody
    • Glutamine--fructose-6-phosphate transaminase 1 antibody
    • Glutamine:fructose 6 phosphate amidotransferase 1 antibody
    • Hexosephosphate aminotransferase 1 antibody
    • MSLG antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling GFPT1 with ab176775 at 1/100 dilution.

  • All lanes : Anti-GFPT1 antibody (ab176775) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Human kidney lysate

    Predicted band size: 77 kDa

References

This product has been referenced in:
  • Li L  et al. High expression of GFAT1 predicts unfavorable prognosis in patients with hepatocellular carcinoma. Oncotarget 8:19205-19217 (2017). IHC ; Human . Read more (PubMed: 28186970) »
  • Yang C  et al. High expression of GFAT1 predicts poor prognosis in patients with pancreatic cancer. Sci Rep 6:39044 (2016). Read more (PubMed: 27996048) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up