Overview

  • Product name
  • Description
    Rabbit polyclonal to GGCT
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GGCT aa 49-174. BC000625
    Sequence:

    FKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQE GVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAK ENGLPLEYQEKLKAIEPNDYTGKVSE


    Database link: O75223

  • Positive control
    • HeLa & 293 cell lysates, Human fetal colon tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab177208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 21 kDa.

Target

  • Function
    Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis.
  • Sequence similarities
    Belongs to the gamma-glutamylcyclotransferase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • C7orf24 antibody
    • CRF21 antibody
    • Cytochrome c-releasing factor 21 antibody
    • Gamma glutamyl cyclotransferase antibody
    • Gamma-glutamylcyclotransferase antibody
    • GCTG antibody
    • GGC antibody
    • Ggct antibody
    • GGCT_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal colon tissue labeling GGCT with ab177208 at 1/100 dilution.

  • All lanes : Anti-GGCT antibody (ab177208) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 293 cell lysate

    Predicted band size: 21 kDa

References

ab177208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up