Anti-GGCT antibody - C-terminal (ab191170)
Key features and details
- Rabbit polyclonal to GGCT - C-terminal
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GGCT antibody - C-terminal
See all GGCT primary antibodies -
Description
Rabbit polyclonal to GGCT - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow -
Immunogen
Synthetic peptide corresponding to Human GGCT aa 139-168 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH).
Sequence:YKKIICMGAKENGLPLEYQEKLKAIEPNDY
Database link: O75223 -
Positive control
- Human Lung tissue; 293T cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab191170 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000. Predicted molecular weight: 21 kDa. | |
IHC-P | 1/100. |
Target
-
Function
Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis. -
Sequence similarities
Belongs to the gamma-glutamylcyclotransferase family. - Information by UniProt
-
Database links
- Entrez Gene: 533374 Cow
- Entrez Gene: 79017 Human
- Entrez Gene: 110175 Mouse
- Omim: 137170 Human
- SwissProt: Q32LE4 Cow
- SwissProt: O75223 Human
- SwissProt: Q9D7X8 Mouse
- Unigene: 530024 Human
see all -
Alternative names
- C7orf24 antibody
- CRF21 antibody
- Cytochrome c-releasing factor 21 antibody
see all
Images
-
Anti-GGCT antibody - C-terminal (ab191170) at 1/1000 dilution + 293 cell lysates at 35 µg
Predicted band size: 21 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GGCT antibody - C-terminal (ab191170)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung tissue labeling GGCT with ab191170 at 1/100 dilution.
Protocols
Datasheets and documents
References (0)
ab191170 has not yet been referenced specifically in any publications.