Overview

  • Product name

  • Description

    Rabbit polyclonal to GGH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Soybean
  • Immunogen

    Recombinant fragment corresponding to Soybean GGH aa 219-293.
    Sequence:

    RYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQ PEKNAFEWATSLKAPHTEDAIRVTQ


    Database link: P93164

  • Positive control

    • WB: Recombinant GGH protein.
  • General notes

     This product was previously labelled as Glutamyl hydrolase gamma

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Target

  • Function

    Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates.
  • Sequence similarities

    Belongs to the peptidase C26 family.
    Contains 1 gamma-glutamyl hydrolase domain.
  • Cellular localization

    Secreted > extracellular space. Lysosome. Melanosome. While its intracellular location is primarily the lysosome, most of the enzyme activity is secreted. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Alternative names

    • Conjugase antibody
    • folylpolygammaglutamyl hydrolase antibody
    • gamma glutamyl hydrolase antibody
    • Gamma-Glu-X carboxypeptidase antibody
    • Gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) antibody
    • Gamma-glutamyl hydrolase antibody
    • GGH antibody
    • GGH_HUMAN antibody
    • gH antibody
    see all

Images

  • All lanes : Anti-GGH antibody (ab222903) at 1/500 dilution

    Lane 1 : Recombinant GGH protein, 60 ng
    Lane 2 : Recombinant GGH protein, 30 ng
    Lane 3 : Recombinant GGH protein, 15 ng
    Lane 4 : Recombinant GGH protein, 7.5 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG


    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab222903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up