Overview

  • Product name

  • Description

    Mouse monoclonal to GGT1/GGT
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GGT1/GGT aa 381-470.
    Sequence:

    TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSIT NEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG


    Database link: P19440

  • General notes

     This product was previously labelled as GGT1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab55138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 61 kDa.
IHC-P Use a concentration of 3 µg/ml.
ICC Use at an assay dependent concentration.
ICC/IF Use a concentration of 1 µg/ml.
Flow Cyt Use 1µg for 106 cells.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracelular GSH level. It is part of the cell antioxidant defense mechanism. Catalyzes the transfer of the glutamyl moiety of glutathione to amino acids and dipeptide acceptors. Alternatively, glutathione can be hydrolyzed to give Cys-Gly and gamma glutamate. Isoform 3 seems to be inactive.
  • Tissue specificity

    Detected in fetal and adult kidney and liver, adult pancreas, stomach, intestine, placenta and lung. Isoform 3 is lung-specific. There are several other tissue-specific forms that arise from alternative promoter usage but that produce the same protein.
  • Pathway

    Sulfur metabolism; glutathione metabolism.
  • Involvement in disease

    Defects in GGT1 are a cause of glutathionuria (GLUTH) [MIM:231950]; also known as gamma-glutamyltranspeptidase deficiency. It is an autosomal recessive disease.
  • Sequence similarities

    Belongs to the gamma-glutamyltransferase family.
  • Post-translational
    modifications

    N-glycosylated on both chains. Contains hexoses, hexosamines and sialic acid residues. Glycosylation profiles tested in kidney and liver tissues reveal the presence of tissue-specific and site-specific glycan composition, despite the overlap in composition among the N-glycans. A total of 36 glycan compositions, with 40 unique structures are observed. Up to 15 different glycans are observed at a single site, with site-specific variation in glycan composition. The difference in glycosylation profiles in the 2 tissues do not affect the enzyme activity.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD224 antibody
    • D22S672 antibody
    • D22S732 antibody
    • Gamma glutamyl transpeptidase antibody
    • Gamma glutamyltransferase 1 antibody
    • Gamma glutamyltranspeptidase 1 antibody
    • Gamma-glutamyltransferase 1 antibody
    • Gamma-glutamyltranspeptidase 1 light chain antibody
    • GGT 1 antibody
    • GGT antibody
    • GGT1 antibody
    • GGT1_HUMAN antibody
    • Glutamyl transpeptidase antibody
    • Glutathione hydrolase 1 antibody
    • GTG antibody
    • Leukotriene C4 hydrolase antibody
    • MGC96892 antibody
    • MGC96904 antibody
    • MGC96963 antibody
    • OTTHUMP00000028921 antibody
    • OTTHUMP00000197959 antibody
    see all

Images

  • GGT1/GGT antibody (ab55138) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human testis.

  • GGT1/GGT antibody (ab55138) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.

  • ICC/IF image of ab55138 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Overlay histogram showing HEK293 cells stained with ab55138 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55138, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.

    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

References

This product has been referenced in:

  • Dayton JR  et al. Straightforward method for singularized and region-specific CNS microvessels isolation. J Neurosci Methods 318:17-33 (2019). Read more (PubMed: 30797797) »
  • Slooter MD  et al. Detecting tumour-positive resection margins after oral cancer surgery by spraying a fluorescent tracer activated by gamma-glutamyltranspeptidase. Oral Oncol 78:1-7 (2018). IHC ; Human . Read more (PubMed: 29496035) »
See all 7 Publications for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Answer

Thank you for contacting us.

While we do not provide explicit expiration dates for our antibodies, we will guaranteethemfor six months from the date of purchase when stored according to our datasheet instructions. For ab41825 and ab55138, we would not recommend storage at 2-8C for longer than 1-2 weeks. For maximum stability, these antibodies should be frozen and repeated freeze / thaw cycles should be avoided. When frozen, the antibodies should be stable for at least one year, possibly 2-3 years.

I hope this helps, please let me know if you need any additional information or assistance.

Read More
Application
Immunocytochemistry
Sample
Mouse Cell (RAW 264.7)
Specification
RAW 264.7
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.1% Triton-X100 in 2% BSA for 15min
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 22°C

Dr. Mahesh Shivananjappa

Verified customer

Submitted May 24 2012

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Monocytes)
Specification
Monocytes
Fixative
BD Cytofix/Cytoperm 20 min
Permeabilization
Yes - BD Cytofix/Cytoperm 20 min
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 25°C

Dr. Mahesh Shivananjappa

Verified customer

Submitted Feb 06 2012

Application
Western blot
Sample
Human Cell lysate - whole cell (Monocytes from Apheresis)
Loading amount
20 µg
Specification
Monocytes from Apheresis
Gel Running Conditions
Reduced Denaturing (8-16% Biorad Criterion Gel with 18 wells)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Dec 12 2011

Answer

Thank you for contacting us with your question. Though the antibody has been tested for reactivity with human and mouse tissues, the protocol may need to be optimized for each tissue. I am not aware of anything specific for mouse staining, but I may be able to help you troubleshoot. Could you tell me more about the protocol used for the immunostaining, to see if I may make some suggestions to improve the results? On the Western blot, what are the molecular weights of the bands that you see? Could you send an image? Do you see the same pattern with human and mouse samples? According to information on the protein database SwissProt, multiple bands may be expected- http://www.uniprot.org/uniprot/P19440 There are at least 3 isoforms, multiple glycosylations, and the protein forms dimers, all of which can cause multiple bands and messy blots. It can be difficult to reduce some of these bands, but there may be some ways to clean up the blot. Could you also send some Western blot protocol information? I look forward to hearing from you. We do guarantee all of our products to work as stated on the datasheets for up to 6 months of purchase, so I would like to assure you that if we can't get the antibody to stain the mouse tissue, I will be happy to send a replacement antibody. Please let me know if you have any questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up