Overview

  • Product name

    Anti-GGTL1 antibody
  • Description

    Rabbit polyclonal to GGTL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human GGTL1 aa 1-225.
    Sequence:

    MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAV SATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQ PGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYD VKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVV QAIVRMAGGWAAASDSRKGGEPAGY


    Database link: Q9BX51

  • Positive control

    • IHC-P: Human kidney tissue and pancreatic cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the gamma-glutamyltransferase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ831C21.1 antibody
    • dJ831C21.2 antibody
    • Gamma glutamyl transpeptidase antibody
    • Gamma glutamyltransferase-like activity 3 antibody
    • Gamma-glutamyltransferase light chain 1 antibody
    • Gamma-glutamyltransferase-like activity 4 antibody
    • Gamma-glutamyltransferase-like protein 6 antibody
    • GGTL1_HUMAN antibody
    • GGTL6 antibody
    • GGTLA3 antibody
    • GGTLA4 antibody
    • GGTLC1 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for GGTL1 using ab238851 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for GGTL1 using ab238851 at 1/100 dilution in immunohistochemical analysis.

References

ab238851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up