Anti-Ghrelin O acyltransferase antibody - N-terminal (ab178893)

Overview

  • Product name
    Anti-Ghrelin O acyltransferase antibody - N-terminal
    See all Ghrelin O acyltransferase primary antibodies
  • Description
    Rabbit polyclonal to Ghrelin O acyltransferase - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide within Human Ghrelin O acyltransferase aa 145-194 (N terminal). The exact sequence is proprietary. Isoform 2
    Sequence:

    FKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS


    Database link: Q96T53-2

  • Positive control
    • MDA-MB-435S whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function
    Mediates the octanoylation of ghrelin at 'Ser-3'. Can use a variety of fatty acids as substrates including octanoic acid, decanoic acid and tetradecanoic acid.
  • Tissue specificity
    Expressed predominantly in stomach with moderate levels in pancreas and relatively low levels in most other tissues.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FKSG89 antibody
    • ghrelin o transferas antibody
    • Ghrelin O-acyltransferase antibody
    • GOAT antibody
    • MBOA4_HUMAN antibody
    • Mboat4 antibody
    • Membrane-bound O-acyltransferase domain-containing protein 4 antibody
    • O-acyltransferase (membrane bound) domain containing 4 antibody
    • O-acyltransferase domain-containing protein 4 antibody
    • OACT4 antibody
    see all

Images

  • Anti-Ghrelin O acyltransferase antibody - N-terminal (ab178893) at 1 µg/ml + MDA-MB-435S whole cell lysates at 10 µg

    Predicted band size: 37 kDa

References

ab178893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up