Overview

  • Product name
  • Description
    Rabbit polyclonal to Giantin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Giantin aa 425-475. The exact sequence is proprietary.
    Sequence:

    DQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQ K


    Database link: Q14789

  • Positive control
    • 293T, HeLa and Jurkat lysates

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 376 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    May participate in forming intercisternal cross-bridges of the Golgi complex.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 372 kDa Golgi complex associated protein antibody
    • 372 kDa Golgi complex-associated protein antibody
    • GCP antibody
    • GCP372 antibody
    • Giantin antibody
    • GOGB1_HUMAN antibody
    • GOLGB1 antibody
    • Golgi autoantigen golgin subfamily a member 1 antibody
    • Golgi autoantigen golgin subfamily b macrogolgin (with transmembrane signal) 1 antibody
    • Golgi autoantigen, golgin subfamily b, macrogolgin 1 antibody
    • Golgi complex associated protein 372kDa antibody
    • Golgi complex-associated protein 372kDa antibody
    • Golgin B1 antibody
    • Golgin B1, golgi integral membrane protein antibody
    • Golgin subfamily B member 1 antibody
    • GOLIM1 antibody
    • Macrogolgin antibody
    • MGC33154 antibody
    see all

Images

  • All lanes : Anti-Giantin antibody (ab174655) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 376 kDa


    Exposure time: 10 seconds
  • ab174655, at 1 &microg/ml, labeling Giantin in 293T whole cell lysate immunoprecipitated using ab174655 at 6 &microg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

References

ab174655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (LNCaP - prostate cancer cells)
Permeabilization
Yes - 0.2% Triton X-100 in PBS
Specification
LNCaP - prostate cancer cells
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Formaldehyde
Username

Dr. Armen Petrosyan

Verified customer

Submitted Mar 20 2018

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (HepG2 cells)
Gel Running Conditions
Reduced Denaturing (10% SDS-PAGE)
Loading amount
30 µg
Specification
HepG2 cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Username

Dr. Armen Petrosyan

Verified customer

Submitted Mar 20 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up