Overview

  • Product name

  • Description

    Rabbit polyclonal to GILT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human GILT aa 1-250. (Expressed in E.coli).
    Sequence:

    MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYL RGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVP YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME EFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQP PHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK


    Database link: P13284

  • Positive control

    • WB: Raji cell lysate; Recombinant human GILT protein. IHC-P: Human lung, prostate cancer, glioma, stomach, prostate and colorectal cancer tissues. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as IFI30

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232915 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function

    Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.
  • Sequence similarities

    Belongs to the GILT family.
  • Post-translational
    modifications

    N-glycosylated. Sugar chains contain mannose-6-phosphate.
    Synthesized as a 35 kDa precursor which is then processed into the mature 30 kDa form via cleavage of N-terminal and C-terminal propeptides. Processing of the precursor is mediated by multiple lysosomal proteases.
  • Cellular localization

    Secreted. Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gamma interferon inducible lysosomal thiol reductase antibody
    • Gamma interferon inducible protein IP 30 antibody
    • Gamma-interferon-inducible lysosomal thiol reductase antibody
    • Gamma-interferon-inducible protein IP-30 antibody
    • GILT antibody
    • GILT_HUMAN antibody
    • IFI 30 antibody
    • IFI30 antibody
    • interferon gamma inducible protein 30 antibody
    • Interferon gamma inducible protein 30 preproprotein antibody
    • IP30 antibody
    • Legumaturain antibody
    • Lysosomal thiol reductase antibody
    • Lysosomal thiol reductase, gamma-interferon-inducible antibody
    see all

Images

  • Anti-GILT antibody (ab232915) at 3 µg/ml + Recombinant human GILT protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • Anti-GILT antibody (ab232915) at 3 µg/ml + Raji (human Burkitt's lymphoma cell line) cell lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human lung tissue stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for GILT using ab232915 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for GILT (green) using ab232915 at 20 µg/ml in ICC/IF, followed by FITC staining.

References

ab232915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up