Overview

  • Product name

    Anti-GilZ / TilZ antibody [OTI1F11]
    See all GilZ / TilZ primary antibodies
  • Description

    Mouse monoclonal [OTI1F11] to GilZ / TilZ
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human GilZ/ TilZ aa 1-134. (NP_004080) produced in HEK-293T cell.
    Sequence:

    MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAI DNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTL ASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV


    Database link: Q99576

  • Positive control

    • WB: pCMV6-ENTRY GilZ / TilZ transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 15 kDa.

Target

  • Function

    Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities.
  • Tissue specificity

    Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage. Also expressed in cells from different hemopoietic cell lineages, including bone marrow cells, CD34+ stem cells, mature B- and T-cells, monocytes and granulocytes. Down-regulated in activated macrophages from inflammatory lesions of delayed-type hypersensitivity (DTH) reactions, such as in tuberculosis and in Crohn disease, whereas in Burkitt lymphoma, persists in macrophages involved in the phagocytosis of apoptotic malignant cells.
  • Sequence similarities

    Belongs to the TSC-22/Dip/Bun family.
  • Domain

    The leucine-zipper is involved in homodimerization.
  • Information by UniProt
  • Database links

  • Alternative names

    • Delta sleep-inducing peptide immunoreactor antibody
    • DIP antibody
    • DSIP immunoreactive leucine zipper protein antibody
    • DSIP-immunoreactive peptide antibody
    • Dsip1 antibody
    • Dsipi antibody
    • GILZ antibody
    • Glucocorticoid-induced leucine zipper protein antibody
    • hDIP antibody
    • Protein DIP antibody
    • T22D3_HUMAN antibody
    • TSC-22-like protein antibody
    • TSC-22-related protein antibody
    • TSC-22R antibody
    • TSC22 domain family protein 3 antibody
    • TSC22 domain family, member 3 antibody
    • TSC22 related inducible leucine zipper 3 antibody
    • TSC22D3 antibody
    see all

Images

  • All lanes : Anti-GilZ / TilZ antibody [OTI1F11] (ab236524) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY GilZ / TilZ transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 15 kDa

References

ab236524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up