Overview

  • Product name
    Anti-GIOT-1 antibody
  • Description
    Rabbit polyclonal to GIOT-1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Dog
  • Immunogen

    Synthetic peptide corresponding to Human GIOT-1 (N terminal).
    Sequence:

    WEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISEC

  • Positive control
    • IHC-P: Human intestine tissue. WB: Fetal thymus lysate.
  • General notes

    Previously labelled as Gonadotropin Inducible Transcription Repressor 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab32597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 66 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    May be involved in transcriptional regulation.
  • Tissue specificity
    Widely expressed, with highest levels in liver, kidney, pancreas, thymus, and small intestine.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • GIOT-1 antibody
    • GIOT1 antibody
    • Gonadotropin inducible ovary transcription repressor 1 antibody
    • Gonadotropin inducible transcription repressor 1 antibody
    • Gonadotropin-inducible ovary transcription repressor 1 antibody
    • Zinc finger protein 461 antibody
    • ZN461_HUMAN antibody
    • ZNF461 antibody
    see all

Images

  • Anti-GIOT-1 antibody (ab32597) at 1.25 µg/ml + Human thymus tissue lysate

    Predicted band size: 66 kDa
    Observed band size: 48 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling GIOT-1 with ab32597 at 4-8µg/ml. Cells with positive label (as indicated by the arrows) are epithelial cells of intestinal vilus. Magnification: 400X.

References

ab32597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab32597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up