Overview

  • Product name

    Anti-GIPC2 antibody
  • Description

    Rabbit polyclonal to GIPC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GIPC2 aa 1-315.
    Sequence:

    MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH GSATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMERLLGGQ LGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVI DSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKK AFEIELRSKAGKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKI DDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGDFAFPDEFV FDVWGVIGDAKRRGL


    Database link: Q8TF65

  • Positive control

    • 293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Tissue specificity

    Expressed at highest levels in ascending colon and at moderate levels in adult kidney. Expressed at low levels in adult pancreas and at very low levels in adult liver. Expression is down-regulated in several primary tumors, such as kidney, colon and rectal tumors.
  • Sequence similarities

    Belongs to the GIPC family.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • GIPC 2 antibody
    • GIPC PDZ domain containing family, member 2 antibody
    • GIPC2 antibody
    • GIPC2_HUMAN antibody
    • Likely ortholog of mouse semaF cytoplasmic domain associated protein 2 antibody
    • PDZ domain protein GIPC2 antibody
    • PDZ domain-containing protein GIPC2 antibody
    • SemaF cytoplasmic domain associated protein 2 antibody
    • Semaphorin cytoplasmic domain associated protein 2 antibody
    • SEMCAP 2 antibody
    • SEMCAP2 antibody
    see all

Images

  • Anti-GIPC2 antibody (ab175272) at 1/500 dilution + 293 cell lysate

    Predicted band size: 34 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up