Overview

  • Product name
  • Description
    Rabbit polyclonal to GITR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Mouse GITR aa 185-225 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGG


    Database link: O35714

  • Positive control
    • IHC-P: Human oral squamous cell carcinoma and mouse lymph node tissues.
  • General notes

     This product was previously labelled as TNFRSF18

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
  • Tissue specificity
    Expressed in lymph node, peripheral blood leukocytes and weakly in spleen.
  • Sequence similarities
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activation inducible TNFR family receptor antibody
    • Activation-inducible TNFR family receptor antibody
    • AITR antibody
    • CD357 antibody
    • GITR antibody
    • GITR D antibody
    • GITR-D antibody
    • GITRD antibody
    • Glucocorticoid induced TNFR related protein antibody
    • glucocorticoid-induced tnf receptor ligand antibody
    • glucocorticoid-induced tnf receptors ligand antibody
    • Glucocorticoid-induced TNFR-related protein antibody
    • TNF receptor superfamily activation inducible protein antibody
    • TNFRSF 18 antibody
    • TNFRSF18 antibody
    • TNR18_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 18 antibody
    • Tumor necrosis factor receptor superfamily member 18 precursor antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human oral squamous cell carcinoma tissue labeling GITR with ab203297 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse lymph node tissue labeling GITR with ab203297 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up