Overview

  • Product name

  • Description

    Rabbit polyclonal to GKN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Rat GKN2 aa 21-184. Two N-terminal tags His-tag and S-tag, Expressed in e.coli
    Sequence:

    KEVFNIFVPGNNGGNVQETVTIDNQENTATINIHSGSCSSTTIFDYKHGY IASRVLSRRACYIIKMDHKAIPALDKLQRFLYEKQTMNAMASTEYTWVKY NPLKSLITKVDWFLFGSPIEQLCKHIPLYEGEVATKPREVGTGGCAKVGI LGILGISICGGIHL


    Database link: Q29TV8

  • Positive control

    • IHC-P: Rat stomach tissue. WB: Recombinant rat GKN2 protein; Mouse and rat stomach lysates.
  • General notes

     This product was previously labelled as Gastrokine 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Expressed in gastric mucosa.
  • Sequence similarities

    Contains 1 BRICHOS domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BLOT antibody
    • Blottin antibody
    • BRICD1B antibody
    • BRICHOS domain containing 1B antibody
    • Down regulated in gastric cancer GDDR antibody
    • Down-regulated in gastric cancer antibody
    • Gastrokine-2 antibody
    • GDDR antibody
    • Gkn2 antibody
    • GKN2_HUMAN antibody
    • PRO813 antibody
    • TFIZ1 antibody
    • Trefoil factor interactions(z) 1 antibody
    • UNQ465/PRO813 antibody
    • VLTI465 antibody
    see all

Images

  • Anti-GKN2 antibody (ab232821) at 2 µg/ml + Rat stomach tissue lysate.

    Predicted band size: 20 kDa

  • Anti-GKN2 antibody (ab232821) at 2 µg/ml + Mouse stomach tissue lysate.

    Predicted band size: 20 kDa

  • Anti-GKN2 antibody (ab232821) at 2 µg/ml + Recombinant rat GKN2 protein.

    Predicted band size: 20 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for GKN2 using ab232821 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab232821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up