Overview

  • Product name

    Anti-GLEPP1/PTPRO antibody
    See all GLEPP1/PTPRO primary antibodies
  • Description

    Rabbit polyclonal to GLEPP1/PTPRO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GLEPP1/PTPRO aa 151-284.
    Sequence:

    TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEE SFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP


    Database link: Q16827

  • Positive control

    • IHC-P: Human kidney tissue.
  • General notes

    Store product undiluted. The antibody solution should be gently mixed before use.

     This product was previously labelled as GLEPP1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab150834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Possesses tyrosine phosphatase activity.
  • Tissue specificity

    Glomerulus of kidney. Also detected in brain, lung and placenta.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
    Contains 8 fibronectin type-III domains.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FMI antibody
    • GLEPP 1 antibody
    • Glomerular epithelial protein 1 antibody
    • hPTP-J antibody
    • Pancreatic carcinoma phosphatase 2 antibody
    • PCP-2 antibody
    • PCP2 antibody
    • Phosphotyrosine phosphatase U2 antibody
    • Protein tyrosine phosphatase PTP U2 antibody
    • Protein tyrosine phosphatase PTPU2 antibody
    • Protein tyrosine phosphatase receptor type O antibody
    • Protein tyrosine phosphatase U2 antibody
    • Protein-tyrosine phosphatase J antibody
    • Protein-tyrosine phosphatase pi antibody
    • Protein-tyrosine phosphatase receptor omicron antibody
    • PTP pi antibody
    • PTP U2 antibody
    • PTP-J antibody
    • PTP-RO antibody
    • PTP-U2 antibody
    • PTPase U2 antibody
    • PTPRO antibody
    • PTPRO_HUMAN antibody
    • PTPROt antibody
    • PTPU 2 antibody
    • PTPU2 antibody
    • R-PTP-O antibody
    • R-PTP-psi antibody
    • Receptor type protein tyrosine phosphatase O antibody
    • Receptor type tyrosine protein phosphatase O antibody
    • Receptor-type protein-tyrosine phosphatase psi antibody
    • Receptor-type tyrosine-protein phosphatase O antibody
    • Receptor-type tyrosine-protein phosphatase U antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labelling GLEPP1/PTPRO with ab150834 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human colon tissue labelling GLEPP1/PTPRO with ab150834 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue labelling GLEPP1/PTPRO with ab150834 at 1/500 dilution.

References

ab150834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab150834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up