Overview

  • Product name

  • Description

    Rabbit polyclonal to GLG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human GLG1 aa 997-1146.
    Sequence:

    LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELC KKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEA LEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY


    Database link: Q92896

  • Positive control

    • WB: U-251 MG sp cell lysate. ICC/IF: U-251 MG cells. IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Images

  • Paraffin embedded human placenta tissue stained for GLG1 with ab224083 (1/200 dilution) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for GLG1 (green) using ab224083 (4 µg/ml) in ICC/IF.

  • All lanes : Anti-GLG1 antibody (ab224083) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) MG cell lysate
    Lane 2 : U-251 (human brain glioma cell line) MG cell lysate

References

ab224083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up