Overview

  • Product name

    Anti-Gli2 antibody [OTI1F9]
    See all Gli2 primary antibodies
  • Description

    Mouse monoclonal [OTI1F9] to Gli2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Gli2 aa 729-1123. Produced in E.coli. (NP_005261).
    Sequence:

    FEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGG PAGLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISP YFSSRRSSEASPLGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGL LNLTPAQQYSLRAKYAAATGGPPPTPLPGLERMSLRTRLALLDAPERTLP AGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGARRASDPVRRPDA LSLPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLARGAYSPRP PSISENVAMEAVAAGVDGAGPEADLGLPEDDLVLPDDVVQYIKAHASGAL DEGTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPSAPM


    Database link: P10070

  • Positive control

    • WB: HEK293T cell lysate transfected with pCMV6-ENTRY Gli2 cDNA. IHC-P: Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab187386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 167 kDa.
IHC-P 1/150.

Perform heat mediated antigen retrieval with Tris-EDTA, pH8.0 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a transcriptional activator. May play a role during embryogenesis. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the TRE-2S regulatory element that augments the Tax-dependent enhancer of human T-cell leukemia virus type 1. Implicated in the transduction of SHH signal.
  • Involvement in disease

    Defects in GLI2 are the cause of holoprosencephaly type 9 (HPE9) [MIM:610829]; also called pituitary anomalies with holoprosencephaly-like features. The primary features of this disease include defective anterior pituitary formation and pan-hypopituitarism, with or without overt forebrain cleavage abnormalities, and holoprosencephaly-like midfacial hypoplasia. Holoprosencephaly is the most common structural anomaly of the brain, in which the developing forebrain fails to correctly separate into right and left hemispheres. Holoprosencephaly is genetically heterogeneous and associated with several distinct facies and phenotypic variability.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylated in vitro by ULK3.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CJS antibody
    • Gli 2 antibody
    • GLI family zinc finger 2 antibody
    • GLI Kruppel family member GLI2 antibody
    • GLI2 antibody
    • GLI2_HUMAN antibody
    • Glioma associated oncogene family zinc finger antibody
    • HPE9 antibody
    • Oncogene GLI2 antibody
    • PHS2 antibody
    • Tax helper protein 1 antibody
    • Tax helper protein 2 antibody
    • Tax helper protein antibody
    • Tax responsive element 2 holding protein antibody
    • Tax responsive element 25 bp sequence binding protein antibody
    • THP antibody
    • THP1 antibody
    • THP2 antibody
    • Zinc finger protein GLI2 antibody
    see all

Images

  • All lanes : Anti-Gli2 antibody [OTI1F9] (ab187386) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY Gli2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 167 kDa

  • Paraffin-embedded Human skin tissue labeling Gli2 with ab187386 at 1/150 dilution in immunohistochemical analysis.

References

ab187386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up