Anti-GAPR-1 antibody (ab122059)
Key features and details
- Rabbit polyclonal to GAPR-1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GAPR-1 antibody -
Description
Rabbit polyclonal to GAPR-1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GAPR-1 aa 2-73.
Sequence:GKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRI LKHSPESSRGQCGENLAWASYD
Database link: Q9H4G4 -
Positive control
- Transfected HEK293T cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122059 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use a concentration of 0.04 - 0.4 µg/ml.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
Target
-
Tissue specificity
Highest expression in lung and peripheral leukocytes, and minor expression in liver and kidney. -
Sequence similarities
Belongs to the CRISP family.
Contains 1 SCP domain. -
Cellular localization
Golgi apparatus membrane. Binds lipid-enriched microdomains of Golgi membranes not only by ionic interactions but also through the myristate. - Information by UniProt
-
Database links
- Entrez Gene: 152007 Human
- Omim: 607141 Human
- SwissProt: Q9H4G4 Human
- Unigene: 493819 Human
-
Alternative names
- 5730414A08Rik antibody
- C77180 antibody
- C9orf19 antibody
see all
Images
-
All lanes : Anti-GAPR-1 antibody (ab122059) at 1/250 dilution
Lane 1 : Negative control (vector only transfected HEK293T lysate)
Lane 2 : GAPR-1-transfected HEK293T over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa))
Developed using the ECL technique. -
All lanes : Anti-GAPR-1 antibody (ab122059) at 1/1000 dilution
Lane 1 : Mouse cell lysate
Lanes 2-3 : Human cell lysate
Lysates/proteins at 20000000 cells per lane.
Secondary
All lanes : HRP-conjugated goat anti-rabbit IgG polyclonal at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Observed band size: 17 kDa why is the actual band size different from the predicted?
Exposure time: 2 minutes
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab122059 has been referenced in 1 publication.
- Zhao D et al. miR-30e targets GLIPR-2 to modulate diabetic nephropathy: in vitro and in vivo experiments. J Mol Endocrinol 59:181-190 (2017). PubMed: 28733476