Overview

  • Product name

  • Description

    Rabbit polyclonal to GliS2/NKL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GliS2/NKL aa 332-505.
    Sequence:

    RPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDL SALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVV SLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLP LLPGTVLDLSTGVNSAASSPEALA


    Database link: Q9BZE0

  • Positive control

    • IHC-P: Human heart tissue. ICC/IF: A549 cells.
  • General notes

     This product was previously labelled as GliS2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Can act either as a transcription repressor or as a transcription activator, depending on the cell context. Represses the transcriptional activation mediated by CTNNB1 in the Wnt pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation.
  • Tissue specificity

    Expressed at high levels in kidney and at low levels in heart, lung and placenta. Expressed in colon.
  • Involvement in disease

    Defects in GLIS2 are the cause of nephronophthisis type 7 (NPHP7) [MIM:611498]. NPHP7 is an autosomal recessive disorder resulting in end-stage renal disease during childhood or adolescence. It is a progressive tubulo-interstitial kidney disorder histologically characterized by modifications of the tubules with thickening of the basement membrane, interstitial fibrosis and, in the advanced stages, medullary cysts.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain

    The C2H2-type zinc finger 1 has a major repressor function and is required for CTNNB1 binding.
  • Post-translational
    modifications

    C-terminus cleavage is induced by interaction with CTNND1 and enhanced by Src tyrosine kinase.
  • Cellular localization

    Nucleus speckle. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ38247 antibody
    • GLI similar 2 antibody
    • GLI-similar 2 antibody
    • GLIS 2 antibody
    • GLIS family zinc finger 2 antibody
    • glis2 antibody
    • GLIS2_HUMAN antibody
    • Kruppel like zinc finger protein GLIS2 antibody
    • Neuronal Krueppel-like protein antibody
    • Zinc finger protein GLIS2 antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for GliS2/NKL using ab238589 at 1/350 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • A549 (human lung carcinoma cell line) cells stained for GliS2/NKL (green) using ab238589 at 1/116 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. 

References

ab238589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up