Overview

  • Product name

  • Description

    Rabbit polyclonal to GliS2/NKL
  • Host species

    Rabbit
  • Specificity

    ab28462 recognises GLIS2/NKL.

  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Dog
  • Immunogen

    Synthetic peptide within Human GliS2/NKL aa 183-232 (N terminal). The exact sequence is proprietary.
    Sequence:

    QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE


    Database link: Q9BZE0

  • Positive control

    • HepG2 whole cell lysate (ab7900)
  • General notes

     This product was previously labelled as GliS2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab28462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 56 kDa (predicted molecular weight: 56 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/312500.

Target

  • Function

    Can act either as a transcription repressor or as a transcription activator, depending on the cell context. Represses the transcriptional activation mediated by CTNNB1 in the Wnt pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation.
  • Tissue specificity

    Expressed at high levels in kidney and at low levels in heart, lung and placenta. Expressed in colon.
  • Involvement in disease

    Defects in GLIS2 are the cause of nephronophthisis type 7 (NPHP7) [MIM:611498]. NPHP7 is an autosomal recessive disorder resulting in end-stage renal disease during childhood or adolescence. It is a progressive tubulo-interstitial kidney disorder histologically characterized by modifications of the tubules with thickening of the basement membrane, interstitial fibrosis and, in the advanced stages, medullary cysts.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain

    The C2H2-type zinc finger 1 has a major repressor function and is required for CTNNB1 binding.
  • Post-translational
    modifications

    C-terminus cleavage is induced by interaction with CTNND1 and enhanced by Src tyrosine kinase.
  • Cellular localization

    Nucleus speckle. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ38247 antibody
    • GLI similar 2 antibody
    • GLI-similar 2 antibody
    • GLIS 2 antibody
    • GLIS family zinc finger 2 antibody
    • glis2 antibody
    • GLIS2_HUMAN antibody
    • Kruppel like zinc finger protein GLIS2 antibody
    • Neuronal Krueppel-like protein antibody
    • Zinc finger protein GLIS2 antibody
    see all

Images

  • Anti-GliS2/NKL antibody (ab28462) at 0.5 µg/ml
    Predicted band size: 56 kDa
    Observed band size: 56 kDa



    GliS2/NKL detected in HepG2 cell lysate. Gel concentration: 12%. A secondary HRP conjugated anti-Rabbit IgG has been used (suggested dilution: 1: 50,000 - 100,000)

References

This product has been referenced in:

  • Yuan J  et al. GLIS2 redundancy causes chemoresistance and poor prognosis of gastric cancer based on co-expression network analysis. Oncol Rep 41:191-201 (2019). Read more (PubMed: 30320360) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for your enquiry. The difference between ab48861 and ab28462 can be found in the purity and concentration. I have listed the differences below and some references that might be useful to you. ab48861 purity: protein A purified concentration: 2mg/ml Ref: Kim,Y.S., et al., (2003) Nucleic Acids Res. 31 (19), 5513-5525 ab28462 purity: immunogen affinity purified concentration: 1mg/ml Ref: Zhang,F., et al., (2002) J. Biol. Chem. 277 (12), 10139-10149 I hope the information above will be helpful. Should you require any further information, please do not hesitate to contact me.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up