Overview

  • Product name

  • Description

    Rabbit polyclonal to GlnRS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GlnRS aa 367-550. (BC000394).
    Sequence:

    GHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPV AYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSS YFWLCNALDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRL FTLTALRRRGFPPEAINNFCARVGVTVAQTTMEP


    Database link: P47897

  • Positive control

    • 293T cell lysate
  • General notes

    Previously labelled as QARS. 

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 88 kDa.

Target

  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • GlnRS antibody
    • Glutamine tRNA ligase antibody
    • Glutamine tRNA synthetase antibody
    • Glutamine--tRNA ligase antibody
    • Glutaminyl tRNA ligase antibody
    • Glutaminyl tRNA synthetase antibody
    • Glutaminyl-tRNA synthetase antibody
    • PRO2195 antibody
    • QARS antibody
    • SYQ_HUMAN antibody
    see all

Images

  • Anti-GlnRS antibody (ab201220) at 1/1000 dilution + 293T cell lysate

    Developed using the ECL technique.

    Predicted band size: 88 kDa

References

ab201220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up