Overview

  • Product name

    Anti-GLO1 antibody [Glo1a]
    See all GLO1 primary antibodies
  • Description

    Mouse monoclonal [Glo1a] to GLO1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Monkey
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human GLO1 aa 1-184.
    Sequence:

    MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM


    Database link: Q04760

  • Positive control

    • HeLa, HepG2, 293T, A431, A549, MCF7, U2OS, K562, monkey COS7, mouse MEF, mouse C2C12 and rat NRK cell lysates; Human prostate and stomach cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab171121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 21 kDa.
IHC-P 1/800. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/800.

Target

  • Function

    Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
  • Pathway

    Secondary metabolite metabolism; methylglyoxal degradation; (R)-lactate from methylglyoxal: step 1/2.
  • Sequence similarities

    Belongs to the glyoxalase I family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aldoketomutase antibody
    • glo1 antibody
    • GLOD1 antibody
    • Glx I antibody
    • GLYI antibody
    • glyoxalase domain containing 1 antibody
    • Glyoxalase I antibody
    • Ketone aldehyde mutase antibody
    • Ketone-aldehyde mutase antibody
    • Lactoyl glutathione lyase antibody
    • Lactoylglutathione lyase antibody
    • LGUL_HUMAN antibody
    • Methylglyoxalase antibody
    • S D lactoylglutathione methylglyoxal lyase antibody
    • S-D-lactoylglutathione methylglyoxal lyase antibody
    see all

Images

  • All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution

    Lane 1 : Wild-type HAP1 whole cell lysate
    Lane 2 : GLO1 knockout HAP1 whole cell lysate
    Lane 3 : HeLa whole cell lysate
    Lane 4 : HepG2 whole cell lysate

    Lysates/proteins at 20 µg per lane.

    Predicted band size: 21 kDa



    Lanes 1 - 4: Merged signal (red and green). Green - ab171121 observed at 21 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab171121 was shown to specifically react with in wild-type HAP1 cells as signal was lost in GLO1 knockout cells. Wild-type and GLO1 knockout samples were subjected to SDS-PAGE. The membrane was blocked with 3% Milk. Ab171121 and ab181602 (Rabbit anti-GAPDH loading control) were incubated overnight at 4°C at 1/1000 dilution and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.

  • Immunohistochemical analysis of deparaffinized Human stomach cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.

  • All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : 293T cell lysate
    Lane 4 : A431 cell lysate
    Lane 5 : A549 cell lysate
    Lane 6 : MCF7 cell lysate
    Lane 7 : U2OS cell lysate
    Lane 8 : K562 cell lysate
    Lane 9 : monkey COS7 cell lysate
    Lane 10 : mouse MEF cell lysate
    Lane 11 : mouse C2C12 cell lysate
    Lane 12 : rat NRK cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Predicted band size: 21 kDa

  • Immunohistochemical analysis of deparaffinized Human prostate cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up