GLP 1 (1-37) (human, rat), Glucagon-like peptide analog (ab142024)

Overview

  • Product name

    GLP 1 (1-37) (human, rat), Glucagon-like peptide analog
  • Description

    Glucagon-like peptide analog
  • Biological description

    Glucagon-like peptide (GLP) 1 analog which is produced through posttranslational processing of proglucagon. Converts intestinal epithelial cells into insulin-producing cells.
  • Purity

    > 95%
  • CAS Number

    87805-34-3
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4169.52
  • Molecular formula

    C186H275N51O59
  • Sequence

    HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
  • PubChem identifier

    16131070
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    This product is supplied in one (or more) pack size which is freeze dried. Therefore the contents may not be readily visible, as they can coat the bottom or walls of the vial. Please see our FAQs and information page for more details on handling.

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

References

This product has been referenced in:

  • Suzuki A  et al. Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into insulin-producing cells. Proc Natl Acad Sci U S A 100:5034-9 (2003). Read more (PubMed: 12702762) »
  • Navarro M  et al. Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J Neurochem 67:1982-91 (1996). Read more (PubMed: 8863504) »
  • Bell GI  et al. Exon duplication and divergence in the human preproglucagon gene. Nature 304:368-71 (0). Read more (PubMed: 6877358) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up