Overview

  • Product name

    Anti-GLP1 [5B10] antibody
    See all GLP1 primary antibodies
  • Description

    Mouse monoclonal [5B10] to GLP1
  • Host species

    Mouse
  • Specificity

    ab191894 reacts with all forms of GLP1 , including precursor and GLP1 (9-37) / GLP1 (9-36amide) metabolite. ab191894 cross-reacts with Liraglutide, a GLP1 agonist.
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig, Hamster, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human GLP1 aa 7-36 (internal sequence). Coupled to a carrier.
    Sequence:

    VAGLFVMLVQGSWQRSLQDTEEKSRSFSAS


    Database link: P01275

  • Epitope

    Mid-molecular epitope of GLP1

Properties

Applications

Our Abpromise guarantee covers the use of ab191894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 21 kDa.
IHC-P 1/3200 - 1/4000.

Target

  • Function

    Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
    GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton. Inhibits beta cell apoptosis.
    GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.
    Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.
    Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
  • Tissue specificity

    Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain.
  • Sequence similarities

    Belongs to the glucagon family.
  • Post-translational
    modifications

    Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GCG antibody
    • Glicentin related polypeptide antibody
    • glicentin-related polypeptide antibody
    • GLP-1 antibody
    • GLP-1(7-36) antibody
    • GLP-1(7-37) antibody
    • GLP-2 antibody
    • GLP1 antibody
    • GLP1, included antibody
    • GLP2 antibody
    • GLP2, included antibody
    • GLUC_HUMAN antibody
    • Glucagon antibody
    • Glucagon like peptide 1 antibody
    • glucagon-like peptide 1 antibody
    • Glucagon-like peptide 1, included antibody
    • Glucagon-like peptide 2 antibody
    • Glucagon-like peptide 2, included antibody
    • GRPP antibody
    • OXM antibody
    • OXY antibody
    • preproglucagon antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreas tissue labelling GLP1 with ab191894 at a dilution of 1/3200. Alpha cells of the Langerhans islet and scattered cells in the exocrine area of the pancreas were stained strongly.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreas tissue labelling GLP1 with ab191894 at a dilution of 1/4000. Signal is stong in alpha cells.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling GLP1 with ab191894 at a dilution of 1/3200. Hepatocytes were stained stongly.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling GLP1 with ab191894 at a dilution of 1/4000. Signal is strong in the cytoplasm of hepatocytes.

References

ab191894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up