Overview

  • Product name
    Anti-GLP1 antibody [11E2]
    See all GLP1 primary antibodies
  • Description
    Mouse monoclonal [11E2] to GLP1
  • Host species
    Mouse
  • Specificity
    This antibody reacts with all forms of GLP 1, including precursor.
  • Tested applications
    Suitable for: ICC/IF, ELISA, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Guinea pig, Cow
  • Immunogen

    Synthetic peptide corresponding to Human GLP1 aa 98-127. The immunogen sequence corresponds to Glucagon-like peptide 1(7-36), one of the chains formed when cleaved. Immunogen was coupled to a carrier and adsorbed onto aluminum hydroxide gel.
    Sequence:

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR


    Database link: P01275

  • Epitope
    This antibody reacts with a mid-molecular epitope of GLP 1 (Glucagon-like peptide 1(7-36)).
  • Positive control
    • ICC/IF: PC12 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab23468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent dilution. PubMed: 20163204
ELISA 1/20000.
WB 1/1000. Predicted molecular weight: 21 kDa.

Target

  • Function
    Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
    GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton. Inhibits beta cell apoptosis.
    GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.
    Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.
    Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
  • Tissue specificity
    Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain.
  • Sequence similarities
    Belongs to the glucagon family.
  • Post-translational
    modifications
    Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • GCG antibody
    • glicentin-related polypeptide antibody
    • GLP-1 antibody
    • GLP-1(7-36) antibody
    • GLP-1(7-37) antibody
    • GLP-2 antibody
    • GLP1 antibody
    • GLP1, included antibody
    • GLP2 antibody
    • GLP2, included antibody
    • GLUC_HUMAN antibody
    • Glucagon antibody
    • Glucagon like peptide 1 antibody
    • glucagon-like peptide 1 antibody
    • Glucagon-like peptide 1, included antibody
    • Glucagon-like peptide 2 antibody
    • Glucagon-like peptide 2, included antibody
    • GRPP antibody
    • OXM antibody
    • OXY antibody
    • preproglucagon antibody
    see all

Images

  • ICC/IF image of ab23468 stained PC12 cells. The cells were 4% formaldehyde (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab23468, 10µg/ml) overnight at +4°C. The secondary antibody (green) was ab96879 Dylight 488 goat anti-mouse IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:
  • Takada Y  et al. Brg1 plays an essential role in development and homeostasis of the duodenum through regulation of Notch signaling. Development 143:3532-3539 (2016). Read more (PubMed: 27510977) »
  • Chepurny OG  et al. Synthetic small molecule GLP-1 secretagogues prepared by means of a three-component indole annulation strategy. Sci Rep 6:28934 (2016). ICC . Read more (PubMed: 27352904) »
See all 5 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Ileum)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mM Citrate pH6
Permeabilization
No
Specification
Ileum
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 22°C
Fixative
10% Normal buffered formalin

Abcam user community

Verified customer

Submitted Apr 30 2018

Answer

Thank you for contacting us. Indeed, we do not have an antibody tested for all the applications/species. We can however provide you with a testing discount if you want to test one of these antibodies against an untested species or application. In regards to know which one to chose, it depends also on your priorities. My comments on different anti GLP-1 antibodies are: -ab23468 - tested in rat, in ELISA, ICC and WB - As this antibody has been tested in applications with denatured epitope (WB), as well as native epitope (ELISA) I think has reasonable chances to provide good signal in IHC-P as well. Click here (or use the following: https://www.abcam.com/index.html?datasheet=23468). -ab23472 - is indeed tested in WB and IHC-P. The alignment of the immunogen with the rat protein is however not very good with 80% identity. As there is though a stretch of identical amino acids, it might work. Please see here the alignment. http://www.ebi.ac.uk/Tools/services/web/toolresult.ebi?jobId=clustalw2-I20110914-131516-0253-48328932-pg&tool=clustalw2&analysis=alignments -ab26278 - indeed this antibody will react with the rat protein in IHC. However it has not been tested in Western blot and as the epitope is linear in Western blot, it is not possible for me to make a prediction whether this antibody might work in Western blot. It would be necessary to assess this experimentally. I would therefore suggest the best option would be to test ab23468 in IHC-P. I can offer a discount off a future purchase if you buy ab23468 now, test it in IHC-P and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. However if you prefer to test one of the other antibodies in rat or WB respectively, I could also provide you with the same testing offer. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test ab23468 in IHC-P (or what other antibody you would prefer to test). I will then send a discount code. This code must be issued before purchasing ab23468 so please wait for my reply before ordering. 2. Purchase ab23468 either by phone, fax, or online (www.abcam.com). 3. Test it in IHC-P. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab23468 turns out to be unsuitable for IHC-P, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up