Overview

  • Product name

    Anti-GLTP antibody
  • Description

    Rabbit polyclonal to GLTP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cow, Chimpanzee
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human GLTP aa 2-209. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG NITKIKAVYDTNPAKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKRGL RFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAA LYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQM NAELNYKV


    Database link: Q9NZD2

  • Positive control

    • IHC-P: Human cerebrum, stomach, stomach cancer, glioma and pancreas tissue. WB: Pig stomach and mouse brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-GLTP antibody (ab231014) at 1 µg/ml

    Lane 1 : Pig stomach tissue lysate
    Lane 2 : Mouse brain tissue lysate

    Secondary
    All lanes : HRP-linked Guinea Pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for GLTP with ab231014 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for GLTP with ab231014 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for GLTP with ab231014 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GLTP with ab231014 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for GLTP with ab231014 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GLTP antibody (ab231014) at 1 µg/ml + recombinant human GLTP protein

    Secondary
    HRP-linked Guinea Pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

References

ab231014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up