Anti-GLTSCR2 antibody (ab235087)
Key features and details
- Rabbit polyclonal to GLTSCR2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GLTSCR2 antibody
See all GLTSCR2 primary antibodies -
Description
Rabbit polyclonal to GLTSCR2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GLTSCR2 aa 227-405.
Sequence:RLHTKPSQAPAVEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLE RQLALPATEQAATQESTFQELCEGLLEESDGEGEPGQGEGPEAGDAEVCP TPARLATTEKKTEQQRRREKAVHRLRVQQAALRAARLRHQELFRLRGIKA QVALRLAELARRQRRRQARREAEADKPRR
Database link: Q9NZM5 -
Positive control
- IHC-P: Human pancreatic tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab235087 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. |
Target
-
Tissue specificity
Expressed at high levels in heart and pancreas, moderate levels in placenta, liver, skeletal muscle, and kidney, and low levels in brain and lung. -
Sequence similarities
Belongs to the GLTSCR2 family. -
Cellular localization
Nucleus > nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 29997 Human
- Omim: 605691 Human
- SwissProt: Q9NZM5 Human
- Unigene: 421907 Human
-
Alternative names
- Glioma tumor suppressor candidate region gene 2 protein antibody
- GLTSCR2 antibody
- GSCR2_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLTSCR2 antibody (ab235087)Paraffin-embedded human pancreatic tissue stained for GLTSCR2 using ab235087 at 1/600 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235087 has not yet been referenced specifically in any publications.
