Overview

  • Product name

  • Description

    Rabbit polyclonal to GLTSCR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human GLTSCR2 aa 396-478.
    Sequence:

    REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSF QRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL


    Database link: Q9NZM5

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human hippocampus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Expressed at high levels in heart and pancreas, moderate levels in placenta, liver, skeletal muscle, and kidney, and low levels in brain and lung.
  • Sequence similarities

    Belongs to the GLTSCR2 family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glioma tumor suppressor candidate region gene 2 protein antibody
    • GLTSCR2 antibody
    • GSCR2_HUMAN antibody
    • p60 antibody
    • PICT1 antibody
    • protein interacting with carboxyl terminus 1 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling GLTSCR2 using ab244368 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human hippocampus tissue stained for GLTSCR2 with ab244368 at a 1/50 dilution in immunohistochemical analysis.

References

ab244368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up