Anti-Glucan endo-1,3-beta-D-glucosidase antibody (ab234665)

Overview

  • Product name

    Anti-Glucan endo-1,3-beta-D-glucosidase antibody
  • Description

    Rabbit polyclonal to Glucan endo-1,3-beta-D-glucosidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Olea europaea
  • Immunogen

    Recombinant fragment corresponding to Glucan endo-1,3-beta-D-glucosidase aa 360-460. Olea europaea.
    Sequence:

    ATPTPTPKAAGSWCVPKPGVSDDQLTGNINYACGQGIDCGPIQPGGACFE PNTVKAHAAYVMNLYYQSAGRNSWNCDFSQTATLTNTNPSYGACNFPSGS N


    Database link: Q94G86

  • Positive control

    • WB: Recombinant Olea europaea Glucan endo-1,3-beta-D-glucosidase protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Images

  • All lanes : Anti-Glucan endo-1,3-beta-D-glucosidase antibody (ab234665) at 1/500 dilution

    Lane 1 : Recombinant Olea europaea Glucan endo-1,3-beta-D-glucosidase protein, 80 ng
    Lane 2 : Recombinant Olea europaea Glucan endo-1,3-beta-D-glucosidase protein, 40 ng
    Lane 3 : Recombinant Olea europaea Glucan endo-1,3-beta-D-glucosidase protein, 20 ng
    Lane 4 : Recombinant Olea europaea Glucan endo-1,3-beta-D-glucosidase protein, 10 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Observed band size: 27 kDa
    why is the actual band size different from the predicted?

References

ab234665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up