Overview

  • Product name

    Anti-Glucocorticoid Receptor beta antibody
    See all Glucocorticoid Receptor beta primary antibodies
  • Description

    Rabbit polyclonal to Glucocorticoid Receptor beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Orangutan, Squirrel monkey
  • Immunogen

    Recombinant fragment corresponding to Human Glucocorticoid Receptor beta aa 598-755.
    Sequence:

    YSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHML YVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKEL GKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSI EFPEMLAE


    Database link: P04150

  • Positive control

    • WB: Recombinant human Glucocorticoid Receptor beta; Pig brain tissue lysate. IHC-P: Human lung cancer and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 86 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. Plays a significant role in transactivation. Involved in nuclear translocation.
  • Tissue specificity

    Widely expressed. In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart.
  • Involvement in disease

    Defects in NR3C1 are a cause of glucocorticoid resistance (GCRES) [MIM:138040]; also known as cortisol resistance. It is a hypertensive, hyperandrogenic disorder characterized by increased serum cortisol concentrations. Inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Post-translational
    modifications

    Increased proteasome-mediated degradation in response to glucocorticoids.
    Phosphorylated in the absence of hormone; becomes hyperphosphorylated in the presence of glucocorticoid. The Ser-203-phosphorylated form is mainly cytoplasmic, and the Ser-211-phosphorylated form is nuclear. Transcriptional activity correlates with the amount of phosphorylation at Ser-211.
    Sumoylated; this reduces transcription transactivation.
    Ubiquitinated; restricts glucocorticoid-mediated transcriptional signaling.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasmic in the absence of ligand, nuclear after ligand-binding and Nucleus. Localized largely in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • GCCR antibody
    • GCR antibody
    • GCR_HUMAN antibody
    • glucocorticoid nuclear receptor variant 1 antibody
    • Glucocorticoid receptor antibody
    • Glucocorticoid receptor beta isoform antibody
    • GR antibody
    • GRL antibody
    • nr3c1 antibody
    • Nuclear receptor subfamily 3 group C member 1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Glucocorticoid Receptor beta using ab233165 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Glucocorticoid Receptor beta using ab233165 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Glucocorticoid Receptor beta antibody (ab233165) at 2 µg/ml + Recombinant human Glucocorticoid Receptor beta

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 86 kDa

  • Anti-Glucocorticoid Receptor beta antibody (ab233165) at 2 µg/ml + Pig brain tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 86 kDa

References

ab233165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up