Overview

  • Product name
    Anti-Glucuronic Acid Epimerase antibody
    See all Glucuronic Acid Epimerase primary antibodies
  • Description
    Rabbit polyclonal to Glucuronic Acid Epimerase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human Glucuronic Acid Epimerase aa 1-617.
    Sequence:

    MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVD GFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVL GLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYD RFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLS TQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDW TVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKF LTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTA HMAAFFAASDWLVRNQDEKGGWPIMVTRKLGEGFKSLEPGWYSAMAQGQA ISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVFMNKHDWYEEY PTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLP LYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKE FVKRWKSYLKGSRAKHN


    Database link: NP_056369.1

  • Positive control
    • Glucuronic Acid Epimerase transfected lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab169024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent dilution.

Target

  • Relevance
    Glucuronic Acid Epimerase (GLCE) is responsible for epimerization of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA) of Heparan sulfate (HS), which endows the nascent polysaccharide chain with the ability to bind growth factors and cytokines (Ghiselli and Agrawal, 2005 [PubMed 15853773]).
  • Cellular localization
    Golgi apparatus membrane; Single-pass type II membrane protein
  • Database links
  • Alternative names
    • D glucuronyl C5 epimerase antibody
    • GLCE antibody
    • Heparin/heparan sulfate:glucuronic acid C5 epimerase antibody
    • HSEPI antibody
    • KIAA0836 antibody
    see all

Images

  • Immunoprecipitation of Glucuronic Acid Epimerase transfected lysate using ab169024 and Protein A Magnetic Bead, and immunoblotted with Anti-Glucuronic Acid Epimerase purified mouse polyclonal antibody.

    Lane 1 Primary: Glucuronic Acid Epimerase mouse polyclonal antibody
    Sample: Glucuronic Acid Epimerase transfected lysate diluted in 16.6X and the loading amount is 36ul.

     

     

References

ab169024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up