Overview

  • Product name
    Anti-Glucuronic Acid Epimerase/GLCE antibody
    See all Glucuronic Acid Epimerase/GLCE primary antibodies
  • Description
    Rabbit polyclonal to Glucuronic Acid Epimerase/GLCE
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human Glucuronic Acid Epimerase/GLCE aa 1-617.
    Sequence:

    MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVD GFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVL GLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYD RFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLS TQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDW TVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKF LTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTA HMAAFFAASDWLVRNQDEKGGWPIMVTRKLGEGFKSLEPGWYSAMAQGQA ISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVFMNKHDWYEEY PTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLP LYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKE FVKRWKSYLKGSRAKHN


    Database link: NP_056369.1

  • Positive control
    • Glucuronic Acid Epimerase/GLCE transfected lysate.
  • General notes

     This product was previously labelled as Glucuronic Acid Epimerase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab169024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent dilution.

Target

  • Relevance
    Glucuronic Acid Epimerase (GLCE) is responsible for epimerization of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA) of Heparan sulfate (HS), which endows the nascent polysaccharide chain with the ability to bind growth factors and cytokines (Ghiselli and Agrawal, 2005 [PubMed 15853773]).
  • Cellular localization
    Golgi apparatus membrane; Single-pass type II membrane protein
  • Database links
  • Alternative names
    • D glucuronyl C5 epimerase antibody
    • GLCE antibody
    • Heparin/heparan sulfate:glucuronic acid C5 epimerase antibody
    • HSEPI antibody
    • KIAA0836 antibody
    see all

Images

  • Immunoprecipitation of Glucuronic Acid Epimerase/GLCE transfected lysate using ab169024 and Protein A Magnetic Bead, and immunoblotted with Anti-Glucuronic Acid Epimerase/GLCE purified mouse polyclonal antibody.

    Lane 1 Primary: Glucuronic Acid Epimerase/GLCE mouse polyclonal antibody
    Sample: Glucuronic Acid Epimerase/GLCE transfected lysate diluted in 16.6X and the loading amount is 36ul.

References

ab169024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up