Overview

  • Product name

    Anti-Glucuronic Acid Epimerase/GLCE antibody
    See all Glucuronic Acid Epimerase/GLCE primary antibodies
  • Description

    Rabbit polyclonal to Glucuronic Acid Epimerase/GLCE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Glucuronic Acid Epimerase/GLCE aa 29-617.
    Sequence:

    NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFP QEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFL PFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFE GYNVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTE KPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPET SEGVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQ LIAFKERDIYYGIGPRTSWSTVTRDLVTDLRKGVGLSNTKAVKPTKIMPK KVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKGGWPIMVTR KLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYK FLSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGE KLGKEARSLYERGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDY HTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN


    Database link: O94923

  • Positive control

    • WB: Rat liver lysate; Mouse kidney lysate. IHC-P: Human appendix and liver tissues.
  • General notes

     This product was previously labelled as Glucuronic Acid Epimerase

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 70 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Glucuronic Acid Epimerase (GLCE) is responsible for epimerization of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA) of Heparan sulfate (HS), which endows the nascent polysaccharide chain with the ability to bind growth factors and cytokines (Ghiselli and Agrawal, 2005 [PubMed 15853773]).
  • Cellular localization

    Golgi apparatus membrane; Single-pass type II membrane protein
  • Database links

  • Alternative names

    • D glucuronyl C5 epimerase antibody
    • GLCE antibody
    • Heparin/heparan sulfate:glucuronic acid C5 epimerase antibody
    • HSEPI antibody
    • KIAA0836 antibody
    see all

Images

  • All lanes : Anti-Glucuronic Acid Epimerase/GLCE antibody (ab236088) at 1/1000 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 70 kDa

  • Paraffin-embedded human appendix tissue stained for Glucuronic Acid Epimerase/GLCE using ab236088 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for Glucuronic Acid Epimerase/GLCE using ab236088 at 1/100 dilution in immunohistochemical analysis.

References

ab236088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up