Overview

  • Product name

  • Description

    Rabbit polyclonal to GluK5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human GluK5 aa 468-517 (internal sequence).
    Sequence:

    EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM

  • Positive control

    • Jurkat cell lysate.
  • General notes

     This product was previously labelled as GRIK5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab85441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 109 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds kainate > quisqualate > domoate > L-glutamate >> AMPA >> NMDA = 1S,3R-ACPD.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK5 subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EAA 2 antibody
    • EAA2 antibody
    • Excitatory amino acid receptor 2 antibody
    • GluK5 antibody
    • GluRgamma2 antibody
    • Glutamate receptor antibody
    • Glutamate receptor KA 2 antibody
    • Glutamate receptor KA-2 antibody
    • Glutamate receptor KA2 antibody
    • Glutamate receptor, ionotropic kainate 5 [Precursor] antibody
    • Glutamate receptor, ionotropic, kainate 5 (gamma 2) antibody
    • Glutamate receptor, ionotropic, kainate 5 antibody
    • GRIK 2 antibody
    • GRIK 5 antibody
    • GRIK2 antibody
    • Grik5 antibody
    • GRIK5_HUMAN antibody
    • iGlu5 antibody
    • ionotropic kainate 5 antibody
    • KA2 antibody
    • MGC118086 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling GluK5 with ab85441 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the membrane of cell processes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - GluK5. Right - Merge.

  • Anti-GluK5 antibody (ab85441) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size: 109 kDa

  • Immunohistochemistry of Mouse Retina tissue at an antibody concentration of 25µg/ml using anti-GluK5 antibody (ab85441)

References

ab85441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunocytochemistry
Sample
Monkey Cultured Cells (COS-7)
Specification
COS-7
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.5% Triton X
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Dr. Taro Fujikawa

Verified customer

Submitted Mar 30 2012

Answer

I am very pleased to hear you would like to accept our offer and test ab85441 in ICC. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for ICC and include this code in the Additional Comments section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.


Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you very much for your interest in ab85441 and ab118954.

To our knowledge, ab85441 and ab118954 have not been tested in ICC. Therefore, I can offer a discount off a future purchase if you buy ab85441 and/or 118954now, test it inICC and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody per antibody tested.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab85441 and/or ab118954in ICC. I will then send a discount code. This code must be issued before purchasing the antibody so please wait for my reply before ordering.

2. Purchase ab85441 and/or 118954 either by phone, fax, or online (www.abcam.com).

3. Test it in ICC.


4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for anyprimary antibodyordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even ifthe antibodyturns out to be unsuitable for ICC, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up