Overview

  • Product name

    Anti-GLUT-7 antibody
  • Description

    Rabbit polyclonal to GLUT-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GLUT-7 aa 43-73.
    Sequence:

    SVVNTPHKVFKSFYNETYFERHATFMDGKLM

  • Positive control

    • Human Liver tissue.
  • General notes

    Previously labelled as SLC2A7. 

Properties

Applications

Our Abpromise guarantee covers the use of ab122604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    High-affinity transporter for glucose and fructose Does not transport galactose, 2-deoxy-d-glucose and xylose.
  • Tissue specificity

    Expressed in small intestine and colon. Weakly expressed in testis and prostate.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • facilitated glucose transporter member 7 antibody
    • Glucose transporter type 7 antibody
    • GLUT-7 antibody
    • GLUT7 antibody
    • GTR7_HUMAN antibody
    • Intestinal facilitative glucose transporter 7 antibody
    • RP5-963K15.3 antibody
    • SLC2A7 antibody
    • Solute carrier family 2 (facilitated glucose transporter), member 7 antibody
    • Solute carrier family 2 antibody
    see all

Images

  • ab122604, at 1/10 dilution, staining GLUT-7 in Paraffin-embedded Human Liver tissue by Immunohistochemistry.

References

ab122604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (TC7 (Caco-2))
Gel Running Conditions
Reduced Denaturing
Loading amount
2 µg
Specification
TC7 (Caco-2)
Blocking step
Antibody diluent (ProteinSimple) as blocking agent for 5 minute(s) · Concentration: 1% · Temperature: RT°C

S Tumova

Verified customer

Submitted Nov 27 2015

Answer

Thank you very much for your inquiry.

I can confirm that we do not have any antibodies against GLUT11.

But I am happy to let you know that we have an anti GLUT7 antibody that is tested and guaranteed for IHC-P. It is named after SLC2A7 which is an alternative name for GLUT7:

ab122604

https://www.abcam.com/index.html?datasheet=122604 (or use the following: https://www.abcam.com/index.html?datasheet=122604).

For GLUT8 and GLUT12 we have antibodies but none that is tested for IHC-P.

If you would like to test this yourself, you would be eligible for our Abtrial program:

https://www.abcam.com/abtrial

I could offer the following antibodies for this program:

GLUT12 : testing discount for ab75441 or ab100993

https://www.abcam.com/index.html?datasheet=75441 (or use the following: https://www.abcam.com/index.html?datasheet=75441).

https://www.abcam.com/index.html?datasheet=100993 (or use the following: https://www.abcam.com/index.html?datasheet=100993).

GLUT8 : testing discount for ab99132

https://www.abcam.com/index.html?datasheet=99132 (or use the following: https://www.abcam.com/index.html?datasheet=99132).

I hope this information is helpful and wish you good luck for your research.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up