Overview

  • Product name

    Anti-GLUT5 antibody - N-terminal
    See all GLUT5 primary antibodies
  • Description

    Rabbit polyclonal to GLUT5 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Synthetic peptide within Human GLUT5 aa 31-80 (N terminal). The exact sequence is proprietary.
    Sequence:

    QYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPF


    Database link: P22732

  • Positive control

    • K562 cell extract.
  • General notes

    Previously labelled as Glucose Transporter 5 GLUT5.

Properties

Applications

Our Abpromise guarantee covers the use of ab190555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 55 kDa.

Target

  • Function

    Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter.
  • Tissue specificity

    Expressed in small intestine, and at much lower levels in kidney, skeletal muscle, and adipose tissue.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Facilitated glucose transporter member 5 antibody
    • Fructose transporter antibody
    • Glucose transporte, kidney antibody
    • Glucose Transporter 5 GLUT5 antibody
    • glucose transporter like protein 5 antibody
    • Glucose transporter type 5 antibody
    • Glucose transporter type 5 small intestine antibody
    • GLUT 5 antibody
    • GLUT-5 antibody
    • GLUT5 antibody
    • GTR5_HUMAN antibody
    • SLC 2A5 antibody
    • SLC2A5 antibody
    • small intestine antibody
    • solute carrier family 2 (facilitated glucose/fructose transporter), member 5 antibody
    • Solute carrier family 2 antibody
    see all

Images

  • Anti-GLUT5 antibody - N-terminal (ab190555) at 1/500 dilution + K562 cell extract at 30 µg

    Predicted band size: 55 kDa

References

ab190555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up