Description

  • Product name

  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
    • Predicted molecular weight

      56 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab105952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-GLUT9 antibody (ab82910)

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names

    • glucose transporter 9
    • Glucose transporter like protein 9
    • Glucose transporter type 9
    • GLUT 9
    • GLUT-9
    • GLUT9
    • GLUTX
    • GTR9_HUMAN
    • Human glucose transporter like protein 9
    • SLC2A9
    • Solute carrier family 2 (facilitated glucose transporter) member 9
    • Solute carrier family 2 facilitated glucose transporter member 9
    • Solute carrier family 2 member 9
    • Solute carrier family 2 member 9 protein
    • Solute carrier family 2, facilitated glucose transporter member 9
    • UAQTL2
    • Urate voltage driven efflux transporter 1
    • URATv1
    see all
  • Function

    Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate.
  • Tissue specificity

    Most strongly expressed in basolateral membranes of proximal renal tubular cells, liver and placenta. Also detected in lung, blood leukocytes, heart skeletal muscle and chondrocytes from articular cartilage. Isoform 2 is only detected in the apical membranes of polarized renal tubular cells and placenta. Isoform 1 and isoform 2 are detected in kidney membrane (at protein level).
  • Involvement in disease

    Hypouricemia renal 2
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization

    Basolateral cell membrane and Apical cell membrane. Basolateral cell membrane.
  • Information by UniProt

References

ab105952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up