For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    glutamate-receptor-3glua3-antibody-ab232887.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmitter Amino Acids Glutamate
Share by email

Anti-Glutamate receptor 3/GluA3 antibody (ab232887)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-Glutamate receptor 3/GluA3 antibody
    See all Glutamate receptor 3/GluA3 primary antibodies
  • Description

    Rabbit polyclonal to Glutamate receptor 3/GluA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Glutamate receptor 3/GluA3 aa 649-823. Expressed in E. coli. N-terminal tags.
    Sequence:

    TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAV YEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRK PCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKW WYDKGECGSGGGDSKDKTSALSLSN


    Database link: P42263

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human Glutamate receptor 3/GluA3 protein. U-87 MG cell lysate. Pig and mouse brain tissue lysate.
  • General notes

    Previously labelled as Glutamate receptor 3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmitter
    • Amino Acids
    • Glutamate
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Ligand-Gated Ion Channels
    • AMPA / Kainate

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Mouse brain tissue lysate - total protein (ab30151)
    • Mouse brain tissue lysate - total protein (ab4022)
  • Recombinant Protein

    • Recombinant Human Glutamate receptor 3/GluA3 protein (ab114562)

Applications

Our Abpromise guarantee covers the use of ab232887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Involvement in disease

    Defects in GRIA3 are the cause of mental retardation X-linked type 94 (MRX94) [MIM:300699]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA3 subfamily.
  • Post-translational
    modifications

    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Target information above from: UniProt accession P42263 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2892 Human
    • Entrez Gene: 53623 Mouse
    • Entrez Gene: 29628 Rat
    • Omim: 305915 Human
    • SwissProt: Q38PU6 Cynomolgus monkey
    • SwissProt: P42263 Human
    • SwissProt: Q9Z2W9 Mouse
    • SwissProt: P19492 Rat
    • Unigene: 377070 Human
    • Unigene: 327681 Mouse
    • Unigene: 74049 Rat
    see all
  • Alternative names

    • AMPA 3 antibody
    • AMPA selective glutamate receptor 3 antibody
    • AMPA-selective glutamate receptor 3 antibody
    • dJ1171F9.1 antibody
    • GluA3 antibody
    • GLUK3 antibody
    • GluR 3 antibody
    • GLUR C antibody
    • GLUR K3 antibody
    • GluR-3 antibody
    • GluR-C antibody
    • GluR-K3 antibody
    • GLUR3 antibody
    • GLURC antibody
    • Glutamate ionotropic receptor AMPA type subunit 3 antibody
    • Glutamate receptor 3 antibody
    • Glutamate receptor C antibody
    • Glutamate receptor ionotrophic AMPA 3 antibody
    • Glutamate receptor ionotropic antibody
    • Glutamate receptor subunit 3 antibody
    • Glutamate receptor, ionotropic, AMPA 3 antibody
    • GRIA 3 antibody
    • Gria3 antibody
    • GRIA3_HUMAN antibody
    • Ionotrophic Glutamate Receptor antibody
    • MRX94 antibody
    see all

Images

  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    All lanes : Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 1 µg/ml

    Lane 1 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) cell lysate
    Lane 2 : Pig brain tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)

    Formalin-fixed, paraffin-embedded human brain tissue stained for Glutamate receptor 3/GluA3 with ab232887 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 5 µg/ml + Recombinant human Glutamate receptor 3/GluA3 protein

Datasheets and documents

    • Datasheet
  • References

    ab232887 has not yet been referenced specifically in any publications.

    Publishing research using ab232887? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab232887.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.