Anti-Glutamate receptor 3/GluA3 antibody (ab232887)

Submit a review Submit a question

Overview

  • Product name

    Anti-Glutamate receptor 3/GluA3 antibody
    See all Glutamate receptor 3/GluA3 primary antibodies

  • Description

    Rabbit polyclonal to Glutamate receptor 3/GluA3

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, IHC-Pmore details

  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cynomolgus monkey

  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Glutamate receptor 3/GluA3 aa 649-823. Expressed in E. coli. N-terminal tags.
    Sequence:

    TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAV YEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRK PCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKW WYDKGECGSGGGDSKDKTSALSLSN


    Database link: P42263

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human Glutamate receptor 3/GluA3 protein. U-87 MG cell lysate. Pig and mouse brain tissue lysate.

  • General notes

    Previously labelled as Glutamate receptor 3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab232887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.

  • Involvement in disease

    Defects in GRIA3 are the cause of mental retardation X-linked type 94 (MRX94) [MIM:300699]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia.

  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA3 subfamily.

  • Post-translational
    modifications

    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.

  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • AMPA 3 antibody
    • AMPA selective glutamate receptor 3 antibody
    • AMPA-selective glutamate receptor 3 antibody
    • dJ1171F9.1 antibody
    • GluA3 antibody
    • GLUK3 antibody
    • GluR 3 antibody
    • GLUR C antibody
    • GLUR K3 antibody
    • GluR-3 antibody
    • GluR-C antibody
    • GluR-K3 antibody
    • GLUR3 antibody
    • GLURC antibody
    • Glutamate ionotropic receptor AMPA type subunit 3 antibody
    • Glutamate receptor 3 antibody
    • Glutamate receptor C antibody
    • Glutamate receptor ionotrophic AMPA 3 antibody
    • Glutamate receptor ionotropic antibody
    • Glutamate receptor subunit 3 antibody
    • Glutamate receptor, ionotropic, AMPA 3 antibody
    • GRIA 3 antibody
    • Gria3 antibody
    • GRIA3_HUMAN antibody
    • Ionotrophic Glutamate Receptor antibody
    • MRX94 antibody
    see all

Images

  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    All lanes : Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 1 µg/ml

    Lane 1 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) cell lysate
    Lane 2 : Pig brain tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)

    Formalin-fixed, paraffin-embedded human brain tissue stained for Glutamate receptor 3/GluA3 with ab232887 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Western blot - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
    Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 5 µg/ml + Recombinant human Glutamate receptor 3/GluA3 protein

References

ab232887 has not yet been referenced specifically in any publications.

Publishing research using ab232887? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab232887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com