Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Glutamate receptor 3/GluA3 antibody
See all Glutamate receptor 3/GluA3 primary antibodies -
Description
Rabbit polyclonal to Glutamate receptor 3/GluA3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human, Pig
Predicted to work with: Rat, Cynomolgus monkey -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human Glutamate receptor 3/GluA3 aa 649-823. Expressed in E. coli. N-terminal tags.
Sequence:TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAV YEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRK PCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKW WYDKGECGSGGGDSKDKTSALSLSN
Database link: P42263 -
Positive control
- IHC-P: Human brain tissue. WB: Recombinant human Glutamate receptor 3/GluA3 protein. U-87 MG cell lysate. Pig and mouse brain tissue lysate.
-
General notes
Previously labelled as Glutamate receptor 3.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232887 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 - 5 µg/ml. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. -
Involvement in disease
Defects in GRIA3 are the cause of mental retardation X-linked type 94 (MRX94) [MIM:300699]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia. -
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA3 subfamily. -
Post-translational
modificationsPalmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis. -
Cellular localization
Cell membrane. Cell junction > synapse > postsynaptic cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2892 Human
- Entrez Gene: 53623 Mouse
- Entrez Gene: 29628 Rat
- Omim: 305915 Human
- SwissProt: Q38PU6 Cynomolgus monkey
- SwissProt: P42263 Human
- SwissProt: Q9Z2W9 Mouse
- SwissProt: P19492 Rat
see all -
Alternative names
- AMPA 3 antibody
- AMPA selective glutamate receptor 3 antibody
- AMPA-selective glutamate receptor 3 antibody
see all
Images
-
All lanes : Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 1 µg/ml
Lane 1 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) cell lysate
Lane 2 : Pig brain tissue lysate
Lane 3 : Mouse brain tissue lysate
Secondary
All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamate receptor 3/GluA3 antibody (ab232887)
Formalin-fixed, paraffin-embedded human brain tissue stained for Glutamate receptor 3/GluA3 with ab232887 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Glutamate receptor 3/GluA3 antibody (ab232887) at 5 µg/ml + Recombinant human Glutamate receptor 3/GluA3 protein
Datasheets and documents
References
ab232887 has not yet been referenced specifically in any publications.