Overview

  • Product name
    Anti-Glutamine Synthetase antibody
    See all Glutamine Synthetase primary antibodies
  • Description
    Rabbit polyclonal to Glutamine Synthetase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WB, IP, IHC-Fr, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog, Pig, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Glutamine Synthetase aa 1-373.
    Sequence:

    MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSE PKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCE VFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWP SNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPA QWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGA GCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN


    Database link: P15104

  • Positive control
    • WB: U-87 MG, HEK-293T, SK-N-SH, IMR32, SK-N-AS whole cell extracts; Mouse eye and brain tissue extracts; Rat brain tissue extract. ICC/IF: DIV9 rat E18 primary cortical neurons. IHC-P: H441 xenograft tissue; Adult mouse retina tissue. IHC-Fr: Adult mouse cerebellum tissue. IP: IMR32 whole cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab228590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/1000.
WB 1/500 - 1/50000. Predicted molecular weight: 42 kDa.
IP 1/100 - 1/500.
IHC-Fr 1/100 - 1/1000.
ICC/IF 1/100 - 1/1000.

Target

  • Function
    This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). Essential for proliferation of fetal skin fibroblasts.
  • Involvement in disease
    Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD) [MIM:610015]. CSGD is a rare developmental disorder with severe brain malformation resulting in multi-organ failure and neonatal death. Glutamine is largely absent from affected patients serum, urine and cerebrospinal fluid.
  • Sequence similarities
    Belongs to the glutamine synthetase family.
  • Developmental stage
    Expressed during early fetal stages.
  • Cellular localization
    Cytoplasm. Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • cell proliferation-inducing protein 59 antibody
    • GLNA antibody
    • GLNA_HUMAN antibody
    • GLNS antibody
    • GLUL antibody
    • Glutamate ammonia ligase antibody
    • Glutamate decarboxylase antibody
    • Glutamate--ammonia ligase antibody
    • glutamine synthase antibody
    • Glutamine synthetase antibody
    • GS antibody
    • PIG 43 antibody
    • PIG 59 antibody
    • PIG43 antibody
    • PIG59 antibody
    • Proliferation inducing protein 43 antibody
    see all

Images

  • Paraffin-embedded adult mouse retina tissue stained for Glutamine Synthetase (green) using ab228590 at 1/250 dilution in immunohistochemical analysis.

    Nuclear counter stain: Fluoroshield with DAPI (blue). beta Tubulin 3/Tuj1 was stained by an anti-beta Tubulin 3/Tuj1 antibody (red) at 1/250 dilution.

  • Paraffin-embedded H441 xenograft tissue stained for Glutamine Synthetase using ab228590 at 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-Glutamine Synthetase antibody (ab228590) at 1/5000 dilution

    Lane 1 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell extract
    Lane 2 : SK-N-SH (human neuroblastoma cell line) whole cell extract
    Lane 3 : IMR32 whole cell extract
    Lane 4 : SK-N-AS whole cell extract

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : HRP-conjugated anti-rabbit IgG

    Predicted band size: 42 kDa



    10% SDS-PAGE gel.

  • Frozen sections of adult mouse cerebellum tissue stained for Glutamine Synthetase (green) using ab228590 at 1/250 dilution in immunohistochemical analysis.

    Nuclear counter stain: Fluoroshield with DAPI (blue). beta Tubulin 3/Tuj1 was stained by an anti-beta Tubulin 3/Tuj1 antibody (red) at 1/500 dilution.

  • Anti-Glutamine Synthetase antibody (ab228590) at 1/20000 dilution + Mouse eye tissue extract at 50 µg

    Secondary
    HRP-conjugated anti-rabbit IgG

    Predicted band size: 42 kDa



    10% SDS-PAGE gel.

  • Paraformaldehyde-fixed DIV9 rat E18 primary cortical neurons stained for Glutamine Synthetase (green) using ab228590 at 1/500 dilution in ICF/IF.

    Nuclear counter stain: Fluoroshield with DAPI (blue). beta Tubulin 3/Tuj1 was stained by an anti-beta Tubulin 3/Tuj1 antibody (red) at 1/500 dilution.

  • Glutamine Synthetase was immunoprecipitated from IMR32 whole cell extract with 5 µg of ab228590. Western blot was performed from the immunoprecipitate using ab228590. Anti-Rabbit IgG was used as a secondary reagent.

    Lane 1: Control IgG instead of ab228590 in IMR32 whole cell extract. 
    Lane 2: ab228590 IP in IMR32 whole cell extract.

  • Anti-Glutamine Synthetase antibody (ab228590) at 1/50000 dilution + Mouse brain tissue extract at 50 µg

    Secondary
    HRP-conjugated anti-rabbit IgG

    Predicted band size: 42 kDa



    10% SDS-PAGE gel.

  • Anti-Glutamine Synthetase antibody (ab228590) at 1/50000 dilution + Rat brain tissue extract at 50 µg

    Secondary
    HRP-conjugated anti-rabbit IgG

    Predicted band size: 42 kDa



    10% SDS-PAGE gel.

  • All lanes : Anti-Glutamine Synthetase antibody (ab228590) at 1/1000 dilution

    Lane 1 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract.
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with Glutamine Synthetase shRNA, whole cell extract.

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : HRP-conjugated anti-rabbit IgG

    Predicted band size: 42 kDa



    10% SDS-PAGE gel.

References

ab228590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up