Overview

  • Product name

    Anti-Glutaminyl cyclase antibody
    See all Glutaminyl cyclase primary antibodies
  • Description

    Rabbit polyclonal to Glutaminyl cyclase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Glutaminyl cyclase aa 162-330.
    Sequence:

    VPCAMMLELARALDKQLFSLKNISDSRPDLSLQLIFFDGEEAFHLWSPQD SLYGSRHLASKMASTPHPPGARDTNQLHGMDLLVLLDLIGAPFPTFPNFF PNTARWFGRLEAIEHGLREL GLLKDHSSERWYFRNYGYGGVIQDDHIPFLRRGVPVLHLISSPFPEVWH


    Database link: Q16769

  • Positive control

    • HepG2 and Jurkat cell line lysate. Human thyroid tissue.
  • General notes

    Previously labelled as QPCT.

Properties

Applications

Our Abpromise guarantee covers the use of ab201172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 41 kDa.

Target

  • Function

    Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
  • Sequence similarities

    Belongs to the glutaminyl-peptide cyclotransferase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5730422A13Rik antibody
    • EC antibody
    • GCT antibody
    • Glutaminyl cyclase antibody
    • Glutaminyl peptide cyclotransferase antibody
    • Glutaminyl tRNA cyclotransferase antibody
    • Glutaminyl-peptide cyclotransferase antibody
    • Glutaminyl-tRNA cyclotransferase antibody
    • Glutamyl cyclase antibody
    • QC antibody
    • qpct antibody
    • QPCT_HUMAN antibody
    • sQC antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded human thyroid tissue labeling Glutaminyl cyclase with ab201172 at a 1/100 dilution.

  • All lanes : Anti-Glutaminyl cyclase antibody (ab201172) at 1/500 dilution

    Lane 1 : HepG2 cell line lysate
    Lane 2 : Jurkat cell line lysate

    Predicted band size: 41 kDa

References

This product has been referenced in:

  • Wang X  et al. Glutaminyl cyclase inhibitor exhibits anti-inflammatory effects in both AD and LPS-induced inflammatory model mice. Int Immunopharmacol 75:105770 (2019). Read more (PubMed: 31377588) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up