Overview

  • Product name

    Anti-Glutaredoxin 5 antibody
    See all Glutaredoxin 5 primary antibodies
  • Description

    Rabbit polyclonal to Glutaredoxin 5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Glutaredoxin 5 aa 32-157. Mature chain lacking the transit peptide.
    Sequence:

    AGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHG VRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQN GDLVEELKKLGIHSALLDEKKDQDSK


    Database link: Q86SX6

  • Positive control

    • IHC-P: Human appendix and colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab237524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Function

    Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis. Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1.
  • Involvement in disease

    Defects in GLRX5 are a cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA) [MIM:205950]. A form of sideroblastic anemia not responsive to pyridoxine. Sideroblastic anemia is characterized by anemia of varying severity, hypochromic peripheral erythrocytes, systemic iron overload secondary to chronic ineffective erythropoiesis, and the presence of bone marrow ringed sideroblasts. Sideroblasts are characterized by iron-loaded mitochondria clustered around the nucleus.
  • Sequence similarities

    Belongs to the glutaredoxin family. Monothiol subfamily.
    Contains 1 glutaredoxin domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf87 antibody
    • Chromosome 14 open reading frame 87 antibody
    • FLB4739 antibody
    • GLRX 5 antibody
    • Glrx5 antibody
    • GLRX5_HUMAN antibody
    • Glutaredoxin 5 homolog antibody
    • Glutaredoxin related protein 5 antibody
    • Glutaredoxin-related protein 5 antibody
    • Glutaredoxin5 antibody
    • GRX5 antibody
    • MGC14129 antibody
    • mitochondrial antibody
    • Monothiol glutaredoxin-5 antibody
    • PRO1238 antibody
    see all

Images

  • Paraffin-embedded human appendix tissue stained for Glutaredoxin using ab237524 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human colon cancer tissue stained for Glutaredoxin using ab237524 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab237524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up