Overview

  • Product name

    Anti-Glutathione S Transferase pi antibody
  • Description

    Rabbit polyclonal to Glutathione S Transferase pi
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rhesus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Glutathione S Transferase pi aa 1-210. (Expressed in E.coli).
    Sequence:

    MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLY GQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDL RCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQIS FADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYV NLPINGNGKQ


    Database link: P09211

  • Positive control

    • IHC-P: Human stomach, kidney and thyroid tissues. WB: A549 and MCF7 cell lysates; Human serum, Pig stomach and skin lysates; Recombinant human Glutathione S Transferase pi protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Glutathione S Transferase pi using ab233112 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Glutathione S Transferase pi using ab233112 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Paraffin-embedded human thyroid tissue stained for Glutathione S Transferase pi using ab233112 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Anti-Glutathione S Transferase pi antibody (ab233112) at 2 µg/ml + Recombinant human Glutathione S Transferase pi protein

    Predicted band size: 23 kDa

  • Anti-Glutathione S Transferase pi antibody (ab233112) at 2 µg/ml + A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 23 kDa

  • Human Amisyn peptide (ab23112) at 2 µg/ml + Human serum

    Predicted band size: 23 kDa

  • Anti-Glutathione S Transferase pi antibody (ab233112) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 23 kDa

  • Anti-Glutathione S Transferase pi antibody (ab233112) at 2 µg/ml + Rat stomach lysate

    Predicted band size: 23 kDa

  • Anti-Glutathione S Transferase pi antibody (ab233112) at 2 µg/ml + Pig skin lysate

    Predicted band size: 23 kDa

References

ab233112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up