Overview

  • Product name
    Anti-Glutathione Synthetase antibody
    See all Glutathione Synthetase primary antibodies
  • Description
    Rabbit polyclonal to Glutathione Synthetase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Glutathione Synthetase aa 1-474.
    Sequence:

    MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPF TLFPSLVPSALLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFT ARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPALKQIEINTISA SFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYG SPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQ DRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQA IAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEK IEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR TKAIEHADGGVAAGVAVLDNPYPV


    Database link: P48637

  • Positive control
    • 293T, HeLa and HT-1080 cell line extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab175263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 52 kDa.

Target

  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 2/2.
  • Involvement in disease
    Defects in GSS are the cause of glutathione synthetase deficiency (GSS deficiency) [MIM:266130]; also known as 5-oxoprolinuria or pyroglutamic aciduria. It is a severe form characterized by an increased rate of hemolysis and defective function of the central nervous system.
    Defects in GSS are the cause of glutathione synthetase deficiency of erythrocytes (GLUSYNDE)[MIM:231900]. Glutathione synthetase deficiency of erythrocytes is a mild form causing hemolytic anemia.
  • Sequence similarities
    Belongs to the eukaryotic GSH synthase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • epididymis secretory sperm binding protein Li 64p antibody
    • epididymis secretory sperm binding protein Li 88n antibody
    • Glutathione synthase antibody
    • Glutathione synthetase antibody
    • GSH S antibody
    • GSH synthetase antibody
    • GSH-S antibody
    • GSHB_HUMAN antibody
    • GSHS antibody
    • GSS antibody
    • HEL-S-64p antibody
    • HEL-S-88n antibody
    • MGC14098 antibody
    • OTTHUMP00000030711 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175263. Blue DAPI for nuclear staining.
  • All lanes : Anti-Glutathione Synthetase antibody (ab175263) at 1/500 dilution

    Lane 1 : 293T cell line lysate
    Lane 2 : HeLa cell line lysate
    Lane 3 : HT-1080 cell line lysate

    Predicted band size: 52 kDa

References

ab175263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up