Anti-Glutathione Synthetase antibody (ab175263)
Key features and details
- Rabbit polyclonal to Glutathione Synthetase
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Glutathione Synthetase antibody
See all Glutathione Synthetase primary antibodies -
Description
Rabbit polyclonal to Glutathione Synthetase -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanWB Human
-
Immunogen
Recombinant full length protein corresponding to Human Glutathione Synthetase aa 1-474.
Sequence:MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPF TLFPSLVPSALLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFT ARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPALKQIEINTISA SFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYG SPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQ DRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQA IAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEK IEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR TKAIEHADGGVAAGVAVLDNPYPV
Database link: P48637 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175263 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
| Application | Species |
|---|---|
| ICC/IF |
Human
|
| WB |
Human
|
| All applications |
Cow
Cynomolgus monkey
|
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF |
Use at an assay dependent concentration.
|
|
| WB |
1/500 - 1/2000. Predicted molecular weight: 52 kDa.
|
| Notes |
|---|
|
ICC/IF
Use at an assay dependent concentration. |
|
WB
1/500 - 1/2000. Predicted molecular weight: 52 kDa. |
Target
-
Pathway
Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 2/2. -
Involvement in disease
Defects in GSS are the cause of glutathione synthetase deficiency (GSS deficiency) [MIM:266130]; also known as 5-oxoprolinuria or pyroglutamic aciduria. It is a severe form characterized by an increased rate of hemolysis and defective function of the central nervous system.
Defects in GSS are the cause of glutathione synthetase deficiency of erythrocytes (GLUSYNDE)[MIM:231900]. Glutathione synthetase deficiency of erythrocytes is a mild form causing hemolytic anemia. -
Sequence similarities
Belongs to the eukaryotic GSH synthase family. - Information by UniProt
-
Database links
- Entrez Gene: 2937 Human
- Omim: 601002 Human
- SwissProt: P48637 Human
- Unigene: 82327 Human
-
Alternative names
- epididymis secretory sperm binding protein Li 64p antibody
- epididymis secretory sperm binding protein Li 88n antibody
- Glutathione synthase antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Glutathione Synthetase antibody (ab175263)Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175263. Blue DAPI for nuclear staining.
-
Western blot - Anti-Glutathione Synthetase antibody (ab175263)All lanes : Anti-Glutathione Synthetase antibody (ab175263) at 1/500 dilution
Lane 1 : 293T cell line lysate
Lane 2 : HeLa cell line lysate
Lane 3 : HT-1080 cell line lysate
Predicted band size: 52 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175263 has not yet been referenced specifically in any publications.