Overview

  • Product name

    Anti-Glycerate kinase antibody - C-terminal
    See all Glycerate kinase primary antibodies
  • Description

    Rabbit polyclonal to Glycerate kinase - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human Glycerate kinase aa 284-523 (C terminal).
    Sequence:

    VKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVL SAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQI PDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRVGAE LRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATF LAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR


    Database link: Q8IVS8-1

  • Positive control

    • WB: NIH/3T3 whole cell lysate; Mouse liver, lung and kidney tissue lysates; Rat lung tissue lysate. IHC-P: Human lung and liver tissues.
  • General notes

    Previously labelled as GLYCTK. 

Properties

Applications

Our Abpromise guarantee covers the use of ab225936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 48,55 kDa.

Target

  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in GLYCTK are the cause of D-glyceric aciduria (D-GA) [MIM:220120]. D-GA is a rare metabolic disease characterized by chronic metabolic acidosis and a highly variable clinical phenotype. Clinical features range from an encephalopathic presentation with seizures, microcephaly, severe mental retardation and early death, to milder manifestations with only speech delay or even normal development.
  • Sequence similarities

    Belongs to the glycerate kinase type-2 family.
  • Cellular localization

    Cytoplasm and Cytoplasm. Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • CG9886 like antibody
    • GLCTK_HUMAN antibody
    • Glycerate kinase antibody
    • Glyctk antibody
    • GLYCTK1 antibody
    • HBeAg binding protein 2 antibody
    • HBeAg binding protein 4 antibody
    • HBeAg-binding protein 4 antibody
    • HBeAgBP4A antibody
    • HBEBP2 antibody
    • HBEBP4 antibody
    see all

Images

  • All lanes : Anti-Glycerate kinase antibody - C-terminal (ab225936) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Rat lung tissue lysate
    Lane 5 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 48,55 kDa
    Observed band size: 55 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lung tissue stained for Glycerate kinase using ab225936 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for Glycerate kinase using ab225936 at 1/100 dilution in immunohistochemical analysis.

References

ab225936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up