Overview

  • Product name

    Anti-Glycerol kinase antibody
    See all Glycerol kinase primary antibodies
  • Description

    Rabbit polyclonal to Glycerol kinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Glycerol kinase aa 2-502.
    Sequence:

    TEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPM EIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNA IVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEG SRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDWD DKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAGDQQAAL FGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNY ALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTG LGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSG IRLHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLA VGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWEEHD E


    Database link: P0A6F3

  • Positive control

    • WB: DH5a whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab193521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB 1/500 - 1/5000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Key enzyme in the regulation of glycerol uptake and metabolism.
  • Tissue specificity

    Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
  • Pathway

    Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
  • Involvement in disease

    Defects in GK are the cause of GK deficiency (GKD) [MIM:307030]. This disease can be either symptomatic with episodic metabolic and CNS decompensation or asymptomatic with hyperglycerolemia and hyperglyceroluria only.
  • Sequence similarities

    Belongs to the FGGY kinase family.
  • Cellular localization

    Mitochondrion outer membrane. Cytoplasm. In sperm and fetal tissues, the majority of the enzyme is bound to mitochondria, but in adult tissues, such as liver found in the cytoplasm.
  • Information by UniProt
  • Database links

    • Alternative names

      • ATP glycerol 3 phosphotransferase antibody
      • ATP:glycerol 3 phosphotransferase antibody
      • ATP:glycerol 3-phosphotransferase antibody
      • D930012N15Rik antibody
      • GK antibody
      • GK1 antibody
      • GKD antibody
      • GLPK_HUMAN antibody
      • Glycerokinase antibody
      • Glycerol kinase antibody
      • OTTHUMP00000023108 antibody
      • OTTHUMP00000023109 antibody
      • OTTHUMP00000215321 antibody
      see all

    Images

    • Anti-Glycerol kinase antibody (ab193521) at 2 µg/ml + DH5a whole cell lysate

      Secondary
      Polyclonal goat anti-rabbit IgG at 1/10000 dilution

      Predicted band size: 57 kDa
      Observed band size: 62 kDa
      why is the actual band size different from the predicted?

    • All lanes : Anti-Glycerol kinase antibody (ab193521) at 3 µg/ml

      Lane 1 : Rosseta bacteria lysate at 80 µg
      Lane 2 : Rosseta bacteria lysate at 40 µg
      Lane 3 : Rosseta bacteria lysate at 20 µg
      Lane 4 : Rosseta bacteria lysate at 10 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

      Predicted band size: 57 kDa
      Observed band size: 57 kDa

    References

    ab193521 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193521.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up