Overview

  • Product name

    Anti-Glycine decarboxylase antibody
    See all Glycine decarboxylase primary antibodies
  • Description

    Rabbit polyclonal to Glycine decarboxylase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Glycine decarboxylase aa 81-268. (Expressed in E.coli).
    Sequence:

    TLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIW RSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQ TMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTI AVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPD


    Database link: P23378

  • Positive control

    • WB: Recombinant human Glycine decarboxylase; mouse and pig liver tissue lysate. IHC-P: Human cerebrum, liver cancer, colorectal cancer, stomach cancer and kidney tissue.
  • General notes

    Previously labelled as GLDC. 

Properties

Applications

Our Abpromise guarantee covers the use of ab232989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 113 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.
  • Involvement in disease

    Defects in GLDC are a cause of non-ketotic hyperglycinemia (NKH) [MIM:605899]; also known as glycine encephalopathy (GCE). NKH is an autosomal recessive disease characterized by accumulation of a large amount of glycine in body fluid and by severe neurological symptoms.
  • Sequence similarities

    Belongs to the gcvP family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • GCE antibody
    • GCSP antibody
    • GCSP_HUMAN antibody
    • GLDC antibody
    • Glycine cleavage system P protein antibody
    • glycine cleavage system protein P antibody
    • Glycine decarboxylase antibody
    • glycine decarboxylase P protein antibody
    • Glycine dehydrogenase (decarboxylating) mitochondrial antibody
    • Glycine dehydrogenase [decarboxylating], mitochondrial antibody
    • Gycine dehydrogenase (decarboxylating) antibody
    • HYGN1 antibody
    • MGC138198 antibody
    • MGC138200 antibody
    • NKH antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Glycine decarboxylase using ab232989 at 30μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Glycine decarboxylase using ab232989 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for Glycine decarboxylase using ab232989 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Glycine decarboxylase using ab232989 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Glycine decarboxylase using ab232989 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Glycine decarboxylase antibody (ab232989) at 2 µg/ml + Recombinant human Glycine decarboxylase protein

    Predicted band size: 113 kDa

  • Anti-Glycine decarboxylase antibody (ab232989) at 2 µg/ml + Mouse liver tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 113 kDa

  • Anti-Glycine decarboxylase antibody (ab232989) at 2 µg/ml + Pig liver tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 113 kDa

References

ab232989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up